KEGG   Polaromonas sp. JS666: Bpro_3601Help
Entry
Bpro_3601         CDS       T00343                                 

Definition
succinate dehydrogenase subunit D (EC:1.3.5.1)
Orthology
K00242  
succinate dehydrogenase membrane anchor subunit
Organism
pol  Polaromonas sp. JS666
Pathway
Citrate cycle (TCA cycle)
Oxidative phosphorylation
Butanoate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Module
Citrate cycle (TCA cycle, Krebs cycle)
Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Succinate dehydrogenase, prokaryotes
Brite
KEGG Orthology (KO) [BR:pol00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    Bpro_3601
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    Bpro_3601
   00650 Butanoate metabolism
    Bpro_3601
  Energy metabolism
   00190 Oxidative phosphorylation
    Bpro_3601
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
3802925..3803290
Genome map
AA seq 121 aa AA seqDB search
MSVNYGSKRIVVGAHYGLRDWLAQRVTAALMALFTLLVLAQILFSKGPIGYDKWAGIFSS
QWMKVLTFTIIIALLWHVWVGMRDIWMDYIKPVGLRLGLQVFTMVWLVACAGWGIQVLWR
L
NT seq 366 nt NT seq  +upstreamnt  +downstreamnt
atgtctgtcaattacggctccaagcgcattgttgtcggcgctcactatggcctgcgcgac
tggctggcccagcgcgtgaccgcggccctgatggccctgttcaccctgctggtactggcc
cagatccttttcagcaaaggccccatcggctacgacaaatgggccggcattttctcatcg
cagtggatgaaggtgctgaccttcaccatcatcatcgccctgctctggcacgtgtgggtc
ggcatgcgcgatatctggatggactacatcaagccggtcgggctgcgcctgggcctgcag
gtgttcaccatggtctggctggtggcgtgcgccggctggggcatccaggtcctgtggcgc
ctgtga

DBGET integrated database retrieval system