KEGG   Polaromonas sp. JS666: Bpro_3616Help
Entry
Bpro_3616         CDS       T00343                                 

Definition
(GenBank) tryptophan synthase, beta chain (EC:4.2.1.20)
  KO
K01696  
tryptophan synthase beta chain [EC:4.2.1.20]
Organism
pol  Polaromonas sp. JS666
Pathway
Glycine, serine and threonine metabolism
Phenylalanine, tyrosine and tryptophan biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of antibiotics
Biosynthesis of amino acids
Module
Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:pol00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    Bpro_3616
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    Bpro_3616
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    Bpro_3616
Enzymes [BR:pol01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     Bpro_3616
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-ProteinID: 
JGI: 
UniProt: 
Position
3818995..3820338
Genome map
AA seq 447 aa AA seqDB search
MFDYHQPDPTGHFGIYGGSFVSETLTHAINELKDAYAKYQNDPEFLAEFHSELAHFVGRP
SPIYHAARMSREQGGAQIYLKREDLNHTGAHKINNTIGQAMLARRMGKTRIIAETGAGQH
GVATATICARYGLECVVYMGSEDVKRQSPNVYRMKLLGATVVPVESGSKTLKDALNEAMR
DWVANVDNTFYIIGTVAGPHPYPMMVRDFQSVIGTECLAQMPEFIGNRQPDAVIACVGGG
SNAMGIFYPYIAHEETRLIGVEAAGEGLESGKHSASLQRGLPGVLHGNRTYVLQNDDGQV
TETHSISAGLDYPGVGPEHAFLKDIGRAEYVGITDTEALEAFHYLCRTEGIIAALESSHA
VAYAMKLAKTMRSDQSILVNLSGRGDKDIGTVADLSGADFYDRPSMRGLAVKGGEQPKEF
SDGPPLGKLAPSGGSAVREATSVGARK
NT seq 1344 nt NT seq  +upstreamnt  +downstreamnt
atgttcgactaccaccaacctgacccgaccggccatttcggcatttacggcggcagtttc
gtttccgagacactgacccacgcgatcaatgagctgaaagacgcctacgcgaagtaccag
aacgacccggaattcctggccgaattccattcagagctggcccacttcgtgggccgtccc
tctcccatttaccatgcggcccgcatgagccgcgaacagggcggtgcgcagatctacctg
aagcgcgaagacctgaaccataccggcgcgcacaagatcaacaacaccatcggccaggcc
atgctggcccgccgcatgggcaagacgcgcatcattgctgaaaccggcgccggccagcac
ggcgtggcaaccgccaccatctgcgcgcgttatggcctggaatgcgtggtctacatgggc
agcgaagacgtcaagcgccagagccccaatgtctaccgcatgaagctgctgggcgccacg
gtggttccggttgaaagcggcagcaagacgctgaaagatgcactcaacgaggccatgcgc
gactgggtcgccaatgtggacaacaccttctacatcatcggcaccgtggcggggccgcac
ccctaccccatgatggtccgcgacttccagagcgtgatcggtaccgaatgcctggcgcaa
atgccggaattcatcggtaaccgccagcccgatgcggtgattgcctgcgtcggtgggggc
agcaatgccatgggcattttctacccctatattgcgcatgaagaaacccgcctgatcggc
gtggaagcggccggcgagggcctggagagcggcaagcactccgcatcgctgcagcgcggc
ctgcccggcgtgctgcacggcaaccgtacctatgtcctgcaaaacgacgatggccaggtg
accgagacgcacagcatcagcgccggactcgactaccccggcgtggggcccgagcatgcc
ttcctgaaggacattggccgcgccgaatatgtgggcatcacggacaccgaagcgctggaa
gccttccattacctgtgccgtaccgagggcatcattgccgcgctggagtccagccacgcc
gtggcctacgcgatgaaacttgccaaaaccatgcgcagcgaccagagcatcctggtcaac
ctgtcgggccggggcgacaaggacatcggcacggtggccgacctctcgggcgcagacttt
tatgaccggccgtcgatgcgcggcctggccgtcaagggcggcgaacaaccaaaggaattt
tccgacgggccgcccctaggaaaattagccccctcggggggcagcgcagtacgcgaagcg
acaagcgtgggggccaggaaatga

DBGET integrated database retrieval system