KEGG   Polaromonas sp. JS666: Bpro_3723Help
Entry
Bpro_3723         CDS       T00343                                 

Definition
UDP-glucose pyrophosphorylase (EC:2.7.7.9)
Orthology
K00963  
UTP--glucose-1-phosphate uridylyltransferase [EC:2.7.7.9]
Organism
pol  Polaromonas sp. JS666
Pathway
Pentose and glucuronate interconversions
Galactose metabolism
Starch and sucrose metabolism
Amino sugar and nucleotide sugar metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:pol00001]
 Metabolism
  Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    Bpro_3723
   00052 Galactose metabolism
    Bpro_3723
   00500 Starch and sucrose metabolism
    Bpro_3723
   00520 Amino sugar and nucleotide sugar metabolism
    Bpro_3723
Enzymes [BR:pol01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.9  UTP---glucose-1-phosphate uridylyltransferase
     Bpro_3723
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
3931400..3932299
Genome map
AA seq 299 aa AA seqDB search
MPKFTLNKAVFPVAGLGTRFLPATKAQPKEMLPVVDKPLIQYAVEEAYAAGIRHMIFVTG
RNKRAIEDHFDTAYELENELEVAQKQELLALVRSVQPDDMNFSYVRQPRSLGLGHAVLCA
EHLVGDEPFAVLLADDLMVGPPGGLPVLAQMAAQYQELHQSVLAVQEVPLAHTRRYGIVA
AEAISPGANPRLMKVQKIVEKPAPEVAPSRMGVAGRYILTPAIFEHIRRQASGVGGEIQL
TDGISSLLAEEAVYALQYQGKRYDCGSKEGFLEATVELALQHPEVGQHFRQYLSGLKLD
NT seq 900 nt NT seq  +upstreamnt  +downstreamnt
atgccaaaattcaccttgaacaaagcggttttccctgttgccgggctcggtacccgcttt
ctgcccgccaccaaagcccagcccaaggaaatgcttcccgttgtggacaagccgctcatc
cagtacgcggtggaagaagcctatgcggcgggtattcgccacatgatttttgtgacagga
cgcaataaacgggccatcgaggatcacttcgataccgcctacgaactggagaacgaactg
gaggtcgcccaaaagcaggaattgctggctttggtgcgttcggttcagcccgacgacatg
aatttttcctatgtccggcagccccgttcgctcggcctcggccatgcagtgctgtgcgcc
gaacacctggtgggcgacgagccttttgccgtgctgctggcggatgacctgatggtgggt
ccgccgggcggtctgccagtcctggcccagatggccgcgcagtaccaggagcttcaccag
tcggtgctggccgtgcaggaggtgcccctggcgcacacgcgccgctatggcatcgtggcc
gcagaagccatcagcccgggggcaaatccgaggctcatgaaggtgcagaaaatcgtggaa
aaaccggcaccggaggtggccccgtcccgcatgggcgtggccggccgctacattctcacg
cccgccatttttgaacatatccgccgccaggcgagcggtgtggggggcgaaattcagttg
actgacggcatctcaagcctgctggccgaggaagccgtttatgccctgcaataccagggc
aagcgttacgactgcggcagcaaggaagggttcctggaagccaccgttgagctggcgctg
caacacccggaagtggggcaacactttcgccaatacctcagcgggctcaagctcgactga

DBGET integrated database retrieval system