KEGG   Polaromonas sp. JS666: Bpro_4517Help
Entry
Bpro_4517         CDS       T00343                                 

Definition
malate synthase G (EC:2.3.3.9)
Orthology
K01638  
malate synthase [EC:2.3.3.9]
Organism
pol  Polaromonas sp. JS666
Pathway
Pyruvate metabolism
Glyoxylate and dicarboxylate metabolism
Metabolic pathways
Microbial metabolism in diverse environments
Carbon metabolism
Module
Glyoxylate cycle
Brite
KEGG Orthology (KO) [BR:pol00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    Bpro_4517
  Carbohydrate metabolism
   00620 Pyruvate metabolism
    Bpro_4517
   00630 Glyoxylate and dicarboxylate metabolism
    Bpro_4517
Enzymes [BR:pol01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.3  Acyl groups converted into alkyl groups on transfer
    2.3.3.9  malate synthase
     Bpro_4517
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
4773023..4775236
Genome map
AA seq 737 aa AA seqDB search
MTTTTTERTPAHRLQVATGLYRFIEDKVLPGTGVDSAAFWQGFDAIVADLAPKNIALLAE
RDRLQSEIDSWHQAHPGPITDMPAYRAFLEQIGYLVAQPANVTTTTADVDAELAEQAGPQ
LVVPILNARYALNAANARWGSLYDALYGTDAISESGGAEKGKAYNPLRGARVIEFARTFL
DQAAPLEAVSHKESAGYTVVDGKLVVTLTNGGRSSLQDNTQLIGYQGDAGAPSSVLLKHN
GIHIDIQIDRSTPIGQSDAAGVSDLVLESALSTILDLEDSVAVVDAEDKVLAYSNWLGIL
QGTLTEEVSKGGKTFTRGLNPDRRYTGAQGGEVTLHGRSLMFVRNVGHLMTNPAILYEGG
REIPEGIMDAVITTTIAMHDLKRKGQPGIRNSRAGSVYIVKPKMHGPQEVAFASELFSRV
EALLGLPENTVKLGIMDEERRTSVNLKACIAAAGARVAFINTGFLDRTGDEMHTAMLAGP
MIRKGDMKTSAWIGAYEKNNVLVGLSCGLRGKAQIGKGMWAMPDLMAAMLEQKIAHPRAG
ANTAWVPSPTAATLHALHYHQVLVSDVQKELEKIDANAERDNILNGLLQIPVVAEARWPA
TEKQQELDNNAQGILGYVVRWIDQGVGCSKVPDIHNVALMEDRATLRISSQHIANWLHHG
VVTKDQVIETFQRMAAVVDKQNASDPLYQNMAGHFDTSAAYKAACDLVFKGLEQPSGYTE
PLLHAWRLKVKAGTASA
NT seq 2214 nt NT seq  +upstreamnt  +downstreamnt
atgaccaccacgaccactgaacgcacgcccgcccaccgcctccaggtggccaccggcctc
taccgctttattgaagacaaggtgctgcccggcaccggcgttgacagcgcggccttctgg
cagggctttgacgccatcgtggccgacctggcgcccaaaaacattgccttgctggccgag
cgcgatcgcctgcaaagcgagatcgacagctggcatcaggcccatcccggccccatcacc
gacatgccggcctaccgcgcctttctggaacagatcggctacctggtggcgcagcccgcc
aacgtgaccaccaccaccgctgatgtcgacgccgaactggccgagcaggccggcccgcaa
ctcgtggtgcccatcctgaatgcccgctacgcgctgaacgcggccaatgcccgctggggc
tcgctctatgacgcgctgtatggcacggacgccatctccgaatccggcggcgccgagaag
ggcaaggcctacaacccgctacgcggcgccagggtgatcgagttcgcgcgcaccttcctc
gaccaggccgccccgctggaggctgtgtcgcacaaggagtcggcgggctacaccgtcgtg
gacggcaagctggttgtgacgctgacgaacggcggccgcagcagcctgcaggacaacacc
cagctcatcggctaccagggcgacgctggcgccccctcgtcggtgctgctcaagcacaac
ggcatccacattgacatccagatcgaccgcagcacaccgattggccagagcgatgcggcc
ggcgtcagcgacctggtgctggagtccgcgctgtccaccatcctggacctggaagactcg
gtcgccgtggtggatgccgaagacaaggtgctggcctacagcaactggctgggcatcctg
cagggcacgctgaccgaagaagtcagcaagggcggcaagaccttcacgcgcggcctgaac
ccggaccgccgatacaccggcgcgcagggcggtgaagtcacgctgcacggccgctcgctg
atgtttgtgcgcaatgttggccacctgatgaccaacccggccatcctgtatgaaggcggc
agggaaattcccgagggcatcatggacgcggtcatcaccacgaccattgccatgcacgac
ctcaagcgcaaaggccagcccggcatcaggaactcgcgcgccggctcggtctacatcgtc
aagcccaagatgcatggcccccaggaggtcgcgtttgcatccgagctgttcagccgcgtc
gaggcactgctgggcctgcccgagaacaccgtgaagctcggcatcatggacgaagagcgc
cgcaccagtgtcaacctgaaggcctgcattgccgcggccggcgcccgcgtggctttcatc
aacaccggcttcctggaccgcaccggcgacgagatgcacaccgccatgctggctggcccc
atgatccgcaagggcgatatgaagaccagcgcctggattggcgcctatgaaaagaacaac
gtgctggtgggcctgtcctgcggcctgcgcggcaaggcgcagatcggcaagggcatgtgg
gccatgcccgacctgatggccgccatgctggagcaaaagattgcgcacccccgcgccggc
gccaacaccgcctgggtgccctcaccgactgccgccaccctgcacgcgctgcactaccac
caggtgctggtgtcggatgtgcagaaggaactcgagaagatcgatgccaatgcggaacgc
gacaacatcctgaatggcctgctgcaaattccggtggtcgccgaagccaggtggccggcg
acggaaaagcagcaggagctggacaacaatgcacagggcatcctgggctacgtggtgcgc
tggatcgaccagggcgtgggctgctccaaggtgcccgacatccacaacgtcgcgctgatg
gaagaccgcgccacgctgcgcatttcgagccagcacatcgccaactggctgcaccatggc
gtggtgacgaaggatcaagtcatcgaaaccttccagcgcatggccgccgtggtcgacaag
cagaacgccagcgacccgctctaccaaaacatggcgggccacttcgacacctcagcggct
tacaaggccgcctgcgacctggtgttcaaggggctggaacagccgagtggctacaccgag
ccgctgctgcatgcctggcggttgaaagtcaaggcgggtacggcttcggcttga

DBGET integrated database retrieval system