KEGG   Polaromonas sp. JS666: Bpro_4517Help
Entry
Bpro_4517         CDS       T00343                                 

Definition
(RefSeq) malate synthase G (EC:2.3.3.9)
  KO
K01638  
malate synthase [EC:2.3.3.9]
Organism
pol  Polaromonas sp. JS666
Pathway
Pyruvate metabolism
Glyoxylate and dicarboxylate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Module
Glyoxylate cycle
Brite
KEGG Orthology (KO) [BR:pol00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    Bpro_4517
  Carbohydrate metabolism
   00620 Pyruvate metabolism
    Bpro_4517
   00630 Glyoxylate and dicarboxylate metabolism
    Bpro_4517
Enzymes [BR:pol01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.3  Acyl groups converted into alkyl groups on transfer
    2.3.3.9  malate synthase
     Bpro_4517
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
4773023..4775236
Genome map
AA seq 737 aa AA seqDB search
MTTTTTERTPAHRLQVATGLYRFIEDKVLPGTGVDSAAFWQGFDAIVADLAPKNIALLAE
RDRLQSEIDSWHQAHPGPITDMPAYRAFLEQIGYLVAQPANVTTTTADVDAELAEQAGPQ
LVVPILNARYALNAANARWGSLYDALYGTDAISESGGAEKGKAYNPLRGARVIEFARTFL
DQAAPLEAVSHKESAGYTVVDGKLVVTLTNGGRSSLQDNTQLIGYQGDAGAPSSVLLKHN
GIHIDIQIDRSTPIGQSDAAGVSDLVLESALSTILDLEDSVAVVDAEDKVLAYSNWLGIL
QGTLTEEVSKGGKTFTRGLNPDRRYTGAQGGEVTLHGRSLMFVRNVGHLMTNPAILYEGG
REIPEGIMDAVITTTIAMHDLKRKGQPGIRNSRAGSVYIVKPKMHGPQEVAFASELFSRV
EALLGLPENTVKLGIMDEERRTSVNLKACIAAAGARVAFINTGFLDRTGDEMHTAMLAGP
MIRKGDMKTSAWIGAYEKNNVLVGLSCGLRGKAQIGKGMWAMPDLMAAMLEQKIAHPRAG
ANTAWVPSPTAATLHALHYHQVLVSDVQKELEKIDANAERDNILNGLLQIPVVAEARWPA
TEKQQELDNNAQGILGYVVRWIDQGVGCSKVPDIHNVALMEDRATLRISSQHIANWLHHG
VVTKDQVIETFQRMAAVVDKQNASDPLYQNMAGHFDTSAAYKAACDLVFKGLEQPSGYTE
PLLHAWRLKVKAGTASA
NT seq 2214 nt NT seq  +upstreamnt  +downstreamnt
atgaccaccacgaccactgaacgcacgcccgcccaccgcctccaggtggccaccggcctc
taccgctttattgaagacaaggtgctgcccggcaccggcgttgacagcgcggccttctgg
cagggctttgacgccatcgtggccgacctggcgcccaaaaacattgccttgctggccgag
cgcgatcgcctgcaaagcgagatcgacagctggcatcaggcccatcccggccccatcacc
gacatgccggcctaccgcgcctttctggaacagatcggctacctggtggcgcagcccgcc
aacgtgaccaccaccaccgctgatgtcgacgccgaactggccgagcaggccggcccgcaa
ctcgtggtgcccatcctgaatgcccgctacgcgctgaacgcggccaatgcccgctggggc
tcgctctatgacgcgctgtatggcacggacgccatctccgaatccggcggcgccgagaag
ggcaaggcctacaacccgctacgcggcgccagggtgatcgagttcgcgcgcaccttcctc
gaccaggccgccccgctggaggctgtgtcgcacaaggagtcggcgggctacaccgtcgtg
gacggcaagctggttgtgacgctgacgaacggcggccgcagcagcctgcaggacaacacc
cagctcatcggctaccagggcgacgctggcgccccctcgtcggtgctgctcaagcacaac
ggcatccacattgacatccagatcgaccgcagcacaccgattggccagagcgatgcggcc
ggcgtcagcgacctggtgctggagtccgcgctgtccaccatcctggacctggaagactcg
gtcgccgtggtggatgccgaagacaaggtgctggcctacagcaactggctgggcatcctg
cagggcacgctgaccgaagaagtcagcaagggcggcaagaccttcacgcgcggcctgaac
ccggaccgccgatacaccggcgcgcagggcggtgaagtcacgctgcacggccgctcgctg
atgtttgtgcgcaatgttggccacctgatgaccaacccggccatcctgtatgaaggcggc
agggaaattcccgagggcatcatggacgcggtcatcaccacgaccattgccatgcacgac
ctcaagcgcaaaggccagcccggcatcaggaactcgcgcgccggctcggtctacatcgtc
aagcccaagatgcatggcccccaggaggtcgcgtttgcatccgagctgttcagccgcgtc
gaggcactgctgggcctgcccgagaacaccgtgaagctcggcatcatggacgaagagcgc
cgcaccagtgtcaacctgaaggcctgcattgccgcggccggcgcccgcgtggctttcatc
aacaccggcttcctggaccgcaccggcgacgagatgcacaccgccatgctggctggcccc
atgatccgcaagggcgatatgaagaccagcgcctggattggcgcctatgaaaagaacaac
gtgctggtgggcctgtcctgcggcctgcgcggcaaggcgcagatcggcaagggcatgtgg
gccatgcccgacctgatggccgccatgctggagcaaaagattgcgcacccccgcgccggc
gccaacaccgcctgggtgccctcaccgactgccgccaccctgcacgcgctgcactaccac
caggtgctggtgtcggatgtgcagaaggaactcgagaagatcgatgccaatgcggaacgc
gacaacatcctgaatggcctgctgcaaattccggtggtcgccgaagccaggtggccggcg
acggaaaagcagcaggagctggacaacaatgcacagggcatcctgggctacgtggtgcgc
tggatcgaccagggcgtgggctgctccaaggtgcccgacatccacaacgtcgcgctgatg
gaagaccgcgccacgctgcgcatttcgagccagcacatcgccaactggctgcaccatggc
gtggtgacgaaggatcaagtcatcgaaaccttccagcgcatggccgccgtggtcgacaag
cagaacgccagcgacccgctctaccaaaacatggcgggccacttcgacacctcagcggct
tacaaggccgcctgcgacctggtgttcaaggggctggaacagccgagtggctacaccgag
ccgctgctgcatgcctggcggttgaaagtcaaggcgggtacggcttcggcttga

DBGET integrated database retrieval system