KEGG   Polaromonas sp. JS666: Bpro_4603Help
Entry
Bpro_4603         CDS       T00343                                 

Definition
arginase (EC:3.5.3.1)
Orthology
K01476  
arginase [EC:3.5.3.1]
Organism
pol  Polaromonas sp. JS666
Pathway
Arginine and proline metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:pol00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    Bpro_4603
  Amino acid metabolism
   00330 Arginine and proline metabolism
    Bpro_4603
Enzymes [BR:pol01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.3  In linear amidines
    3.5.3.1  arginase
     Bpro_4603
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
4883246..4884160
Genome map
AA seq 304 aa AA seqDB search
MTRRIRLIGAPTDIGASTRGSSMGPEALRVAGLQATLEGHGLTVADQGNLVGPANPWQAS
VNGYRHLAEVAAWNRSVHEAVHTALSENDMPILLGGDHCLAIGSISAVARHCRKTGQNLR
VLWLDAHADFNTNDLTPTGNTHGMPVAVLCGHGPAELTGIGGVVPAIQPSAVRQIGIRSV
DQGEKRFVRELGLEVFDMRYIDEMGMRHTMQAALAGMDDNTHLHVSFDVDFLDASFAPGV
GTAVKGGPTYREAQLCMEMIADTGRLASLDVMELNPALDVRNGTAEVALDLMESLFGKST
LMRR
NT seq 915 nt NT seq  +upstreamnt  +downstreamnt
atgaccagacgcatccggctgattggcgccccgaccgacattggcgccagtacccgaggc
tcgtccatgggcccagaagcgctgcgcgtcgcgggactgcaggcaacgctggaaggccac
ggcctgaccgtcgcggaccagggcaatctggtgggaccggccaacccctggcaagcatcc
gttaacggctaccgccacctggccgaagtggctgcgtggaaccgttcggtgcatgaggcc
gtgcataccgcgctcagcgaaaacgacatgccgattttgctgggaggcgaccattgcctg
gccattggctccatcagcgcggtggcgcgccactgccgcaagaccggtcagaacctgcgc
gtgctgtggctggacgcccatgccgacttcaacaccaacgacctgacgcccaccggcaac
acgcacggcatgccggtggccgtgctgtgcggccacgggcctgccgagctgaccggcata
ggcggcgtggtgcccgccatccagccctcggccgtgcggcagatcggcatccgcagcgtg
gaccagggcgaaaagcgctttgtccgggaattgggcctcgaagtgttcgacatgcgttac
atcgacgaaatgggcatgcgccacaccatgcaggcggcactggccggcatggacgacaac
acccacctgcatgtgagttttgatgtcgactttctggacgcctcgtttgcgcccggtgtg
ggcaccgccgtcaagggtgggccgacctaccgcgaggcccagctgtgcatggagatgatt
gccgacaccggccggctggcatcgctggatgtgatggagctcaacccggcgctggatgtg
cgcaacggcacggccgaagtggcactggacctgatggaaagcctgttcggcaagagcacg
ctgatgcggcgctag

DBGET integrated database retrieval system