KEGG   Polaromonas sp. JS666: Bpro_4821Help
Entry
Bpro_4821         CDS       T00343                                 

Definition
cytochrome-c peroxidase (EC:1.11.1.5)
Orthology
K00428  
cytochrome c peroxidase [EC:1.11.1.5]
Organism
pol  Polaromonas sp. JS666
Class
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
5103114..5104100
Genome map
AA seq 328 aa AA seqDB search
MSAVRTTMQTTTSSMLKLVIVMVVWASQPATAALLDEPIQPIPPTLKQDPARADIGRLLF
RDARLSGNGRVSCASCHDLGKGGVDGRARSMGLNDGLTDINTPTVLNAALNFKQFWNGRA
DSLEAQIDHVMQSPVEMGSKWEEVVQKVSQDAGYKSAFAAAYKDGVTKANIQNAIATFER
TLITPNSRFDKFLRGDANAISATEKAGYAKFKQYGCVACHQGVNVGGNMFQKFGVMGNYF
EKRGNPTQADLGRYLVTKVESDKYVFKVPSLRNVALTAPYFHDASAKTLEDAVDIMFRYQ
LGRVASSEDKESIVRFLGTLTGELGTKP
NT seq 987 nt NT seq  +upstreamnt  +downstreamnt
atgtctgcggtccgtacaaccatgcaaacaacgacatcgagcatgttgaagctcgtgatc
gtcatggtcgtctgggcatcccaacccgccactgcggccttgctcgatgagccgatccag
ccgattccgccgaccctgaagcaggatccggctcgcgccgacatcgggcgcctgctgttt
cgcgatgcgcgcctgtccggcaatggccgtgtgtcttgcgccagctgccacgatctgggc
aagggcggtgtcgatggtcgcgcgcgttccatgggactgaatgatgggctgaccgacatc
aacaccccgaccgtgctcaatgccgcgctcaatttcaagcagttctggaacggccgtgcc
gactcgctggaagcacaaattgatcacgtcatgcagagcccggtggagatgggttcaaaa
tgggaagaagtcgtccagaaagtgtcgcaggacgccgggtacaagagcgcatttgcggct
gcctacaaagacggggtcaccaaagcgaatatccagaacgccatcgcgactttcgagcga
accctgatcacgccaaattcgcgctttgacaaatttctgcgtggtgacgccaacgccatt
tccgccaccgagaaagccggatacgcaaagttcaagcagtatggatgcgtcgcctgccac
cagggcgtgaatgtgggcggcaacatgtttcagaagtttggcgtcatgggcaactacttc
gagaagcgcggcaatccgacgcaggccgatcttggccgctatctcgtcaccaaggtggaa
agcgacaaatatgtcttcaaggtgcccagcctgcgcaacgtcgcgctgaccgcgccctac
tttcacgatgcctcggcgaagacgctggaagatgccgttgacatcatgttcaggtaccag
ctcggccgtgtcgcctccagcgaggacaaggaatcgatcgtcaggtttctgggcacgctg
accggtgaactgggcacaaagccgtga

DBGET integrated database retrieval system