KEGG   Polaromonas sp. JS666: Bpro_4872Help
Entry
Bpro_4872         CDS       T00343                                 

Definition
heavy metal translocating P-type ATPase
Orthology
K17686  
Cu+-exporting ATPase [EC:3.6.3.54]
Organism
pol  Polaromonas sp. JS666
Class
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
5160853..5163303
Genome map
AA seq 816 aa AA seqDB search
MSIAETLTTPDTTVALNDWRFPVQGMTCASCVARVEQALRGIAGVLEVNVNFATEQAAVK
ARGDVAMGTLKAAVEKAGYAVTEQPLRLGIEGMTCASCVSRVEKALRQLPGVLSAEVNLA
TETAEVNLMGGTISMPQLIAAVAKAGYQAHEMRAPGDSLADQARAAGKPGAPWWPVALAA
LLSAPLILPMLGALAGRHWMLDGWLQWALATPVQFWLGARFYRAGFKALRARTGNMDLLV
AIGTSAAYGLSVYQLLVHGEHAMDHLYFEASAVVITLVLMGKWMEARAKRQTTEAIRALN
ALRPDTARRRRDGRDEEVAISEVRVGDLVVVRPGERIAVDGNIIEGDTQVDESLITGESL
PVSKHAGDRVTGGAINAEGLIVVRTAAVGAESTLARIVRMVESAQARKAPIQRLVDQVSA
VFVPVVMAIALLTLLGWGLLTGQWEAAILHAVAVLVIACPCALGLATPTAIMAGTGVAAR
HGILIKDAEALEVAHRVKLVAFDKTGTLTQGHPELVALEPYGGSRDALLAWSAAIQAGSE
HPLAKAVVAQAARDGLHVPAASQVQAVAGRGMSAVVEGRALRLGSPRFMQELGVDLGACA
ARAQALEDEGRTVSWLADVTVQPQLLGLMAFGDSLKPAAGPAIARLHALGIQTALITGDN
RGSAESVARQLGIDRVHFQVLPEDKAGILSRLKRELQGTAGHTAMVGDGINDAPALAAAD
VGIAMSTGTDVAMHAAGITLMRGDPALVADAIDISRRTYAKIRQNLFWAFFYNVVGIPLA
AFGLLNPVIAGAAMALSSVSVVMNALLLRRWKGSTT
NT seq 2451 nt NT seq  +upstreamnt  +downstreamnt
atgagcatcgcagaaacattgacaacgcccgataccaccgtggcgctgaacgattggcgc
tttccggtgcagggcatgacctgtgcgtcctgcgtcgcccgggtggagcaggccctgcgc
ggcattgcgggggtgctggaggtcaatgtcaattttgcgaccgagcaggccgccgtcaag
gcgcgtggtgatgtagcgatgggaacgctgaaggccgccgtggagaaggcgggctatgcc
gtcaccgagcagccgctgcggctcggcatagagggcatgacctgcgcgtcctgcgtctcg
cgcgtggagaaggcgctcaggcagctgcccggcgtgctgtcggccgaggtcaatctggcc
accgagacggccgaggtcaatctgatgggtggcacgatctcgatgcctcaactcatcgcc
gcggtggccaaggcgggctaccaggcccacgaaatgcgggcccccggcgacagcctggcc
gatcaggcccgcgccgccggcaagcccggcgcgccgtggtggccggtcgcgctggcggcg
ctcctgtccgcgccgctgatcctgcccatgctgggtgcgctggccggccggcactggatg
ctggacggctggctgcaatgggcgctggccacgccggtgcagttctggctgggtgcgcgc
ttttaccgcgcgggtttcaaggccctgcgcgcccggaccggcaacatggacctgctggtg
gccatcggtacatcagccgcctatggcctcagtgtttaccagctgctggtgcacggcgaa
cacgcgatggatcacctctacttcgaggcctcggccgtcgtgatcacgctggtgctgatg
ggcaaatggatggaagcgcgcgccaagcgccagaccaccgaagcgatccgcgcgctcaat
gcgctgcggccggacaccgcacgccggcgccgcgacggccgggacgaagaggtcgccatc
tccgaggtgcgggtgggcgacctggtcgtggtgcgccccggggaacgcatcgccgtcgac
ggtaacatcatcgaaggcgacacccaggtcgacgagtcgctgatcacgggcgaaagcctg
cccgtcagcaagcacgcgggcgaccgcgtcaccggcggagccatcaacgccgaaggcctg
atcgtggtgcgcaccgcggccgtcggagccgaatccacgctggcgcgcattgtgcgcatg
gtggagtcggcgcaagcccgcaaggcaccgatacagcggctggtcgaccaggtcagcgcg
gtgttcgtgccggtggtcatggccatcgcgctgctgacgctgctgggctggggcttactc
accggccagtgggaggccgccatcctgcatgccgtggccgtgctggtgatcgcctgcccg
tgcgcgctggggctggccacaccgacggccatcatggccggcaccggggtggccgcgcgc
catggcatcctgatcaaggacgccgaggcactggaagtcgcgcaccgcgtcaagctggtg
gcctttgacaagaccggcacgctgacgcagggccatcccgagctggtcgcgctggagcct
tacggcggttcgcgtgatgccctgctggcctggagtgccgccatccaggccggcagcgag
cacccgctggccaaagccgtggtcgcgcaggccgcgcgggacggcctgcacgttcctgcc
gcgtcacaggtgcaggcggtcgccgggcgcggcatgtcggcagtggtcgaggggcgggca
cttcggctgggcagcccgcgcttcatgcaggagctgggggtcgacctgggtgcctgcgcg
gcacgcgcccaggcgctggaggacgaaggccgcaccgtgtcctggctggccgacgtcacc
gtccagccgcaactgctgggcctgatggcgtttggcgacagcctcaagccggccgcaggc
ccggccattgcccggctgcacgcgctgggcatacagaccgccctgatcaccggcgacaac
cgcggcagcgctgaaagcgtggctcgccagcttggcattgaccgggtgcattttcaggtg
ctgccggaagacaaggccggcatcctcagccggctcaagcgggagctgcagggcacggcc
ggccacaccgcgatggtgggcgacggcatcaatgacgcaccggccctggcggccgccgat
gtcggtattgccatgtccaccggcaccgatgtggccatgcatgcggcgggcatcacgctg
atgcgcggcgaccctgcgctggtggccgatgccatcgacatctcgcgccgcacctacgcc
aagatccggcaaaacctgttctgggcatttttctacaacgtggtgggcataccgctggcg
gcctttggcctgctgaacccggtgattgccggtgccgccatggccttgagcagcgtcagc
gtggtgatgaacgcgctgctgctgcggcgctggaaaggaagcacgacatga

DBGET integrated database retrieval system