KEGG   Polaromonas sp. JS666: Bpro_5325Help
Entry
Bpro_5325         CDS       T00343                                 

Definition
Delta-9 acyl-phospholipid desaturase (EC:1.14.19.-)
Orthology
K00507  
stearoyl-CoA desaturase (delta-9 desaturase) [EC:1.14.19.1]
Organism
pol  Polaromonas sp. JS666
Pathway
Biosynthesis of unsaturated fatty acids
Fatty acid metabolism
Class
Metabolism; Overview; Fatty acid metabolism [PATH:pol01212]
Metabolism; Lipid metabolism; Biosynthesis of unsaturated fatty acids [PATH:pol01040]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
2:complement(82947..83921)
Genome map
AA seq 324 aa AA seqDB search
MRLTLPTTSIQTAESVFVIKLRLVLVHLGALCIFFVPFTYQLLVGAVIGYFVRVFAWEGG
SHRYFAHKAYKTSRGFQLFLALLAAAAGVRGPLWWATHHRLHHRTADTAEDPNTPLFRGF
WHGYVGWLFLQENADSNLDATKDLSRYPELVIVNRYQYFAPLVLMALTYAVGQYTPLFGA
KGMGVSALIWVFFLSTALSLQSLFSVGALGHGIKPSVFNHRRFETGDTSTNLGLMAIFTM
GGSWHNNHHRCAVAARSGFYWWQVDLTYYVLRLLKAVGLIWDLRLPSARILEEGRRGAGR
QTAEIAGVAEDLTARQEHGYEGVK
NT seq 975 nt NT seq  +upstreamnt  +downstreamnt
atgagactcacgttgcccactacgagcatacagaccgcagaaagcgtattcgtcatcaag
ctccgcctggtgctggtgcatcttggcgctctctgcatctttttcgtgccattcacctac
cagttgttggtcggtgctgtgattggctactttgtgcgtgtgttcgcgtgggagggcggg
tcgcatcggtactttgcgcacaaggcctacaaaacgtcccgaggctttcaacttttcctc
gcgctcctggcggccgcggccggtgtacgtggccctctttggtgggctactcatcaccga
cttcatcatcggactgcagataccgccgaggatccgaacactccgcttttccgcggcttc
tggcatggctatgtgggttggctctttcttcaagagaacgctgactcgaatctggatgcg
accaaagacctttcgcgatatccggaacttgtgatcgtgaatcgctaccaatatttcgct
ccgctggtgctgatggcactgacgtacgcggttggacagtacacgccgttgttcggggca
aaaggcatgggcgtaagcgccttgatctgggtgtttttcctcagtaccgcgctttcgctt
caatccctgttttcggtgggcgcactgggtcacggcatcaagcccagcgtcttcaatcac
cggcgctttgaaaccggcgacacgtccacgaacctcgggctcatggcgatcttcaccatg
ggaggcagttggcacaacaaccaccaccgctgcgctgtcgcagcgcggtcagggttctat
tggtggcaggtcgatctgacgtactacgttcttcgattgctgaaggcggttggcctgatt
tgggacttgcggctgccatcagctcgaatcttggaagaggggcgcagaggtgctggtcgg
cagaccgctgaaattgcaggggtcgcagaagacctgaccgcgcgccaggagcacggctac
gagggcgtcaagtag

DBGET integrated database retrieval system