KEGG   Polaromonas sp. JS666: Bpro_5563Help
Entry
Bpro_5563         CDS       T00343                                 

Definition
zinc-binding alcohol dehydrogenase
Orthology
K13953  
alcohol dehydrogenase, propanol-preferring [EC:1.1.1.1]
Organism
pol  Polaromonas sp. JS666
Pathway
Glycolysis / Gluconeogenesis
Fatty acid degradation
Tyrosine metabolism
Chloroalkane and chloroalkene degradation
Naphthalene degradation
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Degradation of aromatic compounds
Brite
KEGG Orthology (KO) [BR:pol00001]
 Metabolism
  Overview
   01220 Degradation of aromatic compounds
    Bpro_5563
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Bpro_5563
  Lipid metabolism
   00071 Fatty acid degradation
    Bpro_5563
  Amino acid metabolism
   00350 Tyrosine metabolism
    Bpro_5563
  Xenobiotics biodegradation and metabolism
   00625 Chloroalkane and chloroalkene degradation
    Bpro_5563
   00626 Naphthalene degradation
    Bpro_5563
Enzymes [BR:pol01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.1  alcohol dehydrogenase
     Bpro_5563
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
2:complement(327059..328129)
Genome map
AA seq 356 aa AA seqDB search
MNYRCAHRWAFPTWGAALSEHTDELAAPSGHEVSIRVTHCGMCHSDLHIQAGGFDMGGGK
LTSLERAGATLPLTMGHEIGGEVVEIGPEVTGLALGDKVIVYPWLGCGQCAVCLRGDDHL
CPRAARNLGIQLPGGYADMVRVPHSRYLVPIGTLEPARAATFACAGITAYGAIRKLNPMT
AEDHVAIIGCGGVGMTAVALLSATSKARIVAIDPDPAKREAALRYGAVLAFDPNEAGALR
TIGKACNNDIAGVVDFVGAESTSSLAVNLVRRTGQVVIVGLFGGEFRMPLPMFAIKSLQI
TGSYVAGLEDLRELVALAQRVDLPQIPLELRPMASVNQALDDLAHGRVIGRVVLQP
NT seq 1071 nt NT seq  +upstreamnt  +downstreamnt
atgaattaccgctgcgcccatcgctgggcctttccaacttggggcgctgccctgagcgaa
cacaccgacgagctggccgcgcccagcgggcacgaggtcagcatccgtgtcacgcactgc
ggcatgtgccactccgacctgcacatccaggccggaggctttgacatgggcgggggcaag
ctcacctcgctggagcgcgccggggccacgctgccgctgaccatgggtcatgaaatcggc
ggcgaggtggtggaaatcgggcccgaggtcaccggtttggcgctgggcgacaaggtcatt
gtctacccctggctgggttgcggccagtgtgccgtgtgcctgcgcggcgacgaccacctg
tgcccgcgcgccgcgcgcaatctcggcatccagttaccgggcggttatgcggacatggtg
cgcgtgccgcacagccgttacctggtgccgatcggcacgctggagccggcccgtgccgcc
acctttgcctgcgccggtatcacggcttacggcgccatccgcaagctcaacccgatgacg
gccgaggaccatgtggccatcatcggctgtggcggggtgggcatgaccgcagtggcactg
ctgtcggccacttccaaggcccgcatcgtcgccatcgaccccgacccggccaagcgcgaa
gccgccctgcgttacggcgccgtgctggcttttgacccgaatgaagccggcgcactgcgc
accatcggcaaggcctgtaacaacgacatcgcaggcgtggtggattttgtcggcgctgag
tccacatcgtcgctggccgtcaatctggtgcgccgcaccgggcaggtggtgatcgtcggc
ttgttcggcggcgagttccgcatgccgctacccatgttcgcgatcaagtcgctgcagatc
accggctcctatgtggccggcctggaagacttgcgtgagctggtggcgctggcgcagcgg
gtggacctgccgcagattccgctggagttgcggccgatggccagcgtcaaccaggcgctg
gacgacctggcgcacgggcgggttattgggcgcgtggtgctgcagccttga

DBGET integrated database retrieval system