KEGG   Polaribacter sp. MED152: MED152_00455Help
Entry
MED152_00455      CDS       T02533                                 

Definition
O-glycosyl hydrolase family 30
Orthology
K01201  
glucosylceramidase [EC:3.2.1.45]
Organism
pom  Polaribacter sp. MED152
Pathway
Other glycan degradation
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:pom00001]
 Metabolism
  Lipid metabolism
   00600 Sphingolipid metabolism
    MED152_00455
  Glycan biosynthesis and metabolism
   00511 Other glycan degradation
    MED152_00455
Enzymes [BR:pom01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.45  glucosylceramidase
     MED152_00455
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
119793..121289
Genome map
AA seq 498 aa AA seqDB search
MKFSKNVCFLLFVISLLGCNNDSKVLDVQVFETSAAGNNLVALETLSDNTSDNRFQVTLK
PNQTKQTITGFGGSFTEASAYLLNNLSKKNRDSIIEAYFGESGAKYSLTRTHMNSSDFSL
SNYSYAPVENDMELEHFSIQEDLGDIIPMIKDAMKVSKDGFKILSSPWTASPWMKNNKNY
VGGKLLPEYHDTWALFFSKYVSAYKEVGIDIWGFTVENEPLGNGNNWESMHYTPDEMTNF
VQNHLGPQLRKDYPEVKILGYDQNREHLKEWVDSQYKNEETSSYFDGTAIHWYASTYHYY
PDELQYAHQKAPNKYLIQSEACVDSEIPKWKDDAWYWSKEATDWGWDWAPEKDKPMHPKY
APVNRYARDIIGCLNNYVDGWIDWNMVLNKQGGPNWFKNWCVAPVIVDENADEIYFTPLY
YVMTHFSRYIRPEAKIFEVTHSDKDLMITAAKNTDGSIAVVIFNEKQKDKKISLMLNNKS
VNIDIKGQSLQTIVISQS
NT seq 1497 nt NT seq  +upstreamnt  +downstreamnt
atgaaatttagtaaaaatgtttgcttcttgttatttgttataagtctattaggctgcaat
aatgactctaaggtgttagatgttcaagtttttgaaacatcagcagctggaaataattta
gtagcattagaaactttatcagacaatacttcagataatcgatttcaggtgaccctgaaa
ccaaatcaaactaaacaaactattacaggttttggtggttcttttacagaagcttcagct
tatctcttgaataacttaagcaaaaagaatagagattctatcattgaagcttattttggt
gaatcaggagcaaagtattctttaacaagaactcatatgaattcgtctgatttttcacta
tctaattactcttatgctccagtagaaaatgatatggagttagagcattttagcattcag
gaagatttaggtgatataattccgatgattaaagatgctatgaaagtatctaaagacgga
ttcaaaattttatcctctccttggacagcatcaccttggatgaagaacaataaaaattat
gtaggaggtaaattactacctgaatatcatgacacttgggctttattcttttcaaaatat
gtatcagcttataaagaagttgggattgatatttggggatttactgttgaaaatgagcct
ttaggaaatggtaataactgggaaagtatgcactacactccagatgaaatgaccaatttt
gtgcaaaatcatttagggccacaattaagaaaggattatcctgaggtaaaaattttggga
tatgatcaaaatagagaacatttaaaagagtgggtagactcacagtacaaaaacgaggaa
acctcttcttattttgatggtacagccattcactggtatgcaagtacctatcattattat
ccagatgagttgcaatatgctcatcaaaaagcaccaaataaatacttaatccaatcagag
gcttgtgtagattctgaaattccaaaatggaaagatgatgcctggtattggtctaaagaa
gctacagattggggttgggattgggctcctgaaaaagacaaaccaatgcatcctaaatac
gcgccagttaacagatatgcaagagatattattggttgtttaaataactatgtagatggt
tggatagattggaacatggttttaaacaaacaaggaggtccaaactggtttaagaattgg
tgtgttgcaccagttattgttgatgaaaatgccgatgaaatttattttacacctttatat
tatgtaatgactcacttttcaagatatataaggccagaagcgaaaatttttgaagtaact
cattcagataaagatttaatgattactgctgctaaaaatacagatggttctattgcagtt
gttatttttaatgagaaacaaaaagataaaaagataagtttaatgctaaataataaaagt
gttaacatagatataaaagggcaatcgttgcaaacaattgttatttcacaatcataa

DBGET integrated database retrieval system