KEGG   Polaribacter sp. MED152: MED152_00455Help
Entry
MED152_00455      CDS       T02533                                 

Definition
O-glycosyl hydrolase family 30
Orthology
K01201  
glucosylceramidase [EC:3.2.1.45]
Organism
pom  Polaribacter sp. MED152
Pathway
Other glycan degradation
Metabolic pathways
Class
Metabolism; Lipid metabolism; Sphingolipid metabolism
Metabolism; Glycan biosynthesis and metabolism; Other glycan degradation [PATH:pom00511]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
119793..121289
Genome map
AA seq 498 aa AA seqDB search
MKFSKNVCFLLFVISLLGCNNDSKVLDVQVFETSAAGNNLVALETLSDNTSDNRFQVTLK
PNQTKQTITGFGGSFTEASAYLLNNLSKKNRDSIIEAYFGESGAKYSLTRTHMNSSDFSL
SNYSYAPVENDMELEHFSIQEDLGDIIPMIKDAMKVSKDGFKILSSPWTASPWMKNNKNY
VGGKLLPEYHDTWALFFSKYVSAYKEVGIDIWGFTVENEPLGNGNNWESMHYTPDEMTNF
VQNHLGPQLRKDYPEVKILGYDQNREHLKEWVDSQYKNEETSSYFDGTAIHWYASTYHYY
PDELQYAHQKAPNKYLIQSEACVDSEIPKWKDDAWYWSKEATDWGWDWAPEKDKPMHPKY
APVNRYARDIIGCLNNYVDGWIDWNMVLNKQGGPNWFKNWCVAPVIVDENADEIYFTPLY
YVMTHFSRYIRPEAKIFEVTHSDKDLMITAAKNTDGSIAVVIFNEKQKDKKISLMLNNKS
VNIDIKGQSLQTIVISQS
NT seq 1497 nt NT seq  +upstreamnt  +downstreamnt
atgaaatttagtaaaaatgtttgcttcttgttatttgttataagtctattaggctgcaat
aatgactctaaggtgttagatgttcaagtttttgaaacatcagcagctggaaataattta
gtagcattagaaactttatcagacaatacttcagataatcgatttcaggtgaccctgaaa
ccaaatcaaactaaacaaactattacaggttttggtggttcttttacagaagcttcagct
tatctcttgaataacttaagcaaaaagaatagagattctatcattgaagcttattttggt
gaatcaggagcaaagtattctttaacaagaactcatatgaattcgtctgatttttcacta
tctaattactcttatgctccagtagaaaatgatatggagttagagcattttagcattcag
gaagatttaggtgatataattccgatgattaaagatgctatgaaagtatctaaagacgga
ttcaaaattttatcctctccttggacagcatcaccttggatgaagaacaataaaaattat
gtaggaggtaaattactacctgaatatcatgacacttgggctttattcttttcaaaatat
gtatcagcttataaagaagttgggattgatatttggggatttactgttgaaaatgagcct
ttaggaaatggtaataactgggaaagtatgcactacactccagatgaaatgaccaatttt
gtgcaaaatcatttagggccacaattaagaaaggattatcctgaggtaaaaattttggga
tatgatcaaaatagagaacatttaaaagagtgggtagactcacagtacaaaaacgaggaa
acctcttcttattttgatggtacagccattcactggtatgcaagtacctatcattattat
ccagatgagttgcaatatgctcatcaaaaagcaccaaataaatacttaatccaatcagag
gcttgtgtagattctgaaattccaaaatggaaagatgatgcctggtattggtctaaagaa
gctacagattggggttgggattgggctcctgaaaaagacaaaccaatgcatcctaaatac
gcgccagttaacagatatgcaagagatattattggttgtttaaataactatgtagatggt
tggatagattggaacatggttttaaacaaacaaggaggtccaaactggtttaagaattgg
tgtgttgcaccagttattgttgatgaaaatgccgatgaaatttattttacacctttatat
tatgtaatgactcacttttcaagatatataaggccagaagcgaaaatttttgaagtaact
cattcagataaagatttaatgattactgctgctaaaaatacagatggttctattgcagtt
gttatttttaatgagaaacaaaaagataaaaagataagtttaatgctaaataataaaagt
gttaacatagatataaaagggcaatcgttgcaaacaattgttatttcacaatcataa

DBGET integrated database retrieval system