KEGG   Polaribacter sp. MED152: MED152_02025Help
Entry
MED152_02025      CDS       T02533                                 

Gene name
hisD
Definition
(GenBank) histidinol dehydrogenase
  KO
K00013  histidinol dehydrogenase [EC:1.1.1.23]
Organism
pom  Polaribacter sp. MED152
Pathway
pom00340  Histidine metabolism
pom01100  Metabolic pathways
pom01110  Biosynthesis of secondary metabolites
pom01230  Biosynthesis of amino acids
Module
pom_M00026  Histidine biosynthesis, PRPP => histidine
Brite
KEGG Orthology (KO) [BR:pom00001]
 Metabolism
  Amino acid metabolism
   00340 Histidine metabolism
    MED152_02025 (hisD)
Enzymes [BR:pom01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.23  histidinol dehydrogenase
     MED152_02025 (hisD)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Histidinol_dh Zw10 FTCD_C CTP_transf_like Tape_meas_lam_C
Motif
Other DBs
NCBI-ProteinID: EAQ41453
UniProt: A2U269
Position
439284..440567
Genome map
AA seq 427 aa AA seqDB search
MKVILNPKKETWSKILERPTKTVDDIEASVSRIFKEVQETGDDAVNKYTNQFDQVQLASN
LVSEEEIKNAANNVSESLKTAINTAYNNISKFHEAQKTSKVAVETTNGVKCWQEKRPIQK
VGLYIPGGTAPLFSTVLMLAIPAQIAGCKEIVLCSPPNSEGEINPAILYTANLCGVTKII
KVGGIQAIAGLTFGTANIPQVYKIFGPGNQYVTVAKQLATKFGVAIDMPAGPSELLVVAD
DAAKASYVASDLLSQAEHGVDSQVILVSTSQQLIDDVEIELNTQIEQLSRKEIAKKAIAN
SKSILVDNDEIALDLINDYGPEHFIVCTKDNDYYIDNIANAGSVFIGNYTPESAGDYASG
TNHTLPTNGFSKAYSGVNLDSFMKSITFQEISKEGILDIGSAIEIMAAAEGLDAHKNAVT
LRLKDLQ
NT seq 1284 nt NT seq  +upstreamnt  +downstreamnt
atgaaggttattttaaatcctaaaaaagaaacttggtctaaaatactagaaagaccaaca
aaaactgtagatgatattgaagcttcagtttctagaatttttaaagaagttcaagaaaca
ggtgatgatgctgttaataaatataccaaccagtttgatcaagttcagttagcctctaat
ttggtttctgaagaagaaataaaaaatgcagcaaacaatgtttctgaaagtttaaaaaca
gctattaatactgcatataataatattagtaagtttcacgaggcgcagaaaacaagtaag
gttgctgtagaaactacgaatggtgtaaaatgttggcaggaaaaaagacctatccaaaaa
gtaggtttatacattccaggagggacagctcctcttttttctacagtgctaatgttagca
attcctgctcaaattgcaggttgcaaagaaattgttttatgctcaccaccaaattcagaa
ggtgagatcaatccagccatattatataccgctaatttatgtggtgtaactaaaataatt
aaagttggaggtatacaggccatagctggtttaacttttggtactgcaaatattccacaa
gtttataaaatttttggaccaggaaatcaatacgtaacagttgcaaaacaattggctaca
aaatttggtgttgccattgatatgcctgcaggacctagtgaattgttagtagttgcagat
gatgcagctaaagcaagttatgtagcttcagatttattaagccaagcagaacatggagta
gattctcaagtcatcctggtgtcaacttctcaacaattgattgatgatgttgaaattgaa
ttaaatactcaaattgaacaattgtctagaaaagaaatcgctaaaaaggccattgcaaat
tcaaaatctattctggttgataatgatgaaatagcattagatttaataaacgattatggt
ccagaacactttatagtttgtactaaagacaatgattattatatagataacatagcaaat
gctggttctgtttttattggtaattatactccagaaagtgcaggagattatgcttcagga
acaaaccatacattaccaacaaacggattttctaaagcctattcaggtgttaacctagat
agctttatgaaaagtattacgtttcaagaaatatctaaagaaggaattttagatattggt
agtgccatagaaattatggctgcagcagaaggtttagatgcgcacaaaaatgcggtgaca
cttcgtttaaaagatttgcaataa

DBGET integrated database retrieval system