KEGG   Polaribacter sp. MED152: MED152_05075Help
Entry
MED152_05075      CDS       T02533                                 

Definition
hypothetical protein
Orthology
K00690  
sucrose phosphorylase [EC:2.4.1.7]
Organism
pom  Polaribacter sp. MED152
Pathway
Starch and sucrose metabolism
Brite
KEGG Orthology (KO) [BR:pom00001]
 Metabolism
  Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    MED152_05075
Enzymes [BR:pom01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.7  sucrose phosphorylase
     MED152_05075
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1127610..1129340)
Genome map
AA seq 576 aa AA seqDB search
MKDQAISNGVMFNAYPDSIGTKLSDIVKLFQRPEFKDVFSLFYVLPTFFNSDLDRGFSII
DYNLNDELVSQEDLVDLKQLNIELKFDIVLNHLSVASPQFKDLIEKGEASKYKDFFINWN
TFWEGKGSLDENGIMIPDKEYLDKLFMRKSGLPVLQVPFPDGSLKPYWNTFYQKITPNPI
KLKDLENIVQESNVKVDQLLNDINQAIEDGENLETINFGSFDNFKQELLHHVYMNSTFLG
QMDVNAKSDLVWEFYQETLKKVSNFGGKILRLDAFAYLHKQVGETNFFNKPGTWNYLRKI
KTIADDYNLMLLPEIHAEYGVKLHEEVAKEGYFIYDFFLPGLTIHTIESKNNRALFKWIH
EIIDKNYKTVNMLGCHDGIPVLDLKGKEVEGDYNQGLLKDEEIENVMTTILNRGGRVKNL
YDAEGNKISYYQVNATYFSALNEDETKLLIARAIQMFMPGIPQVWYLDLFAGKNDYEAAD
KAGSGGHKEINRTNLSLDQINIGLQKEVVLKQLDLIRFRNTSNVFSGTININSKSDDVID
ITWSLANEKASLYINLNTLELRVNHNDKEGLITSII
NT seq 1731 nt NT seq  +upstreamnt  +downstreamnt
atgaaagatcaagcaatttctaatggagtaatgtttaatgcatatccagatagtataggt
actaaacttagtgatatcgtaaaactttttcaaagaccagagtttaaagatgttttttct
ttattctatgtgctgcctactttttttaatagcgatttagatagagggttctctatcatc
gattataatttaaatgatgaattggtttctcaagaagatttagttgacttaaagcaatta
aatatcgaattaaaattcgacatagttctaaatcatttatcagttgcatcacctcaattt
aaagatttaattgaaaaaggtgaagcttctaaatacaaagatttttttatcaattggaat
accttttgggaaggtaaagggtctttagatgaaaatggaatcatgattccagataaggaa
tatttagataagctttttatgcgaaaatctggcttaccagttttgcaagttccatttcct
gatggatctctaaaaccttattggaataccttttatcaaaaaattactccaaatcctatc
aaactaaaagatctcgaaaacatagttcaagaaagtaatgttaaagtagatcaattgttg
aatgatattaatcaagcaattgaggatggagagaatctagagaccataaactttggttct
ttcgataactttaaacaagaacttttacatcatgtttatatgaattcgacctttttaggt
cagatggatgtaaatgcaaaatctgatttagtttgggagttttatcaagaaactctgaaa
aaggtaagcaactttggaggaaaaattttaagattagatgcttttgcgtatttacacaaa
caagtaggtgaaactaacttttttaataagccaggaacttggaattatttacgtaaaatt
aaaactattgcagatgattataacttaatgttattgcctgaaattcatgcagaatatggg
gtaaaattgcatgaagaagtagcaaaagaaggttactttatctacgattttttcctgcca
ggtttaaccattcataccatagaatctaagaataatagagccttatttaaatggattcat
gaaattattgacaaaaactataaaactgtgaatatgctaggttgtcatgatggaatacca
gttttagacttaaaaggtaaagaggttgaaggtgattataaccaaggacttttaaaagat
gaggaaattgagaatgtaatgacaaccatattaaatagaggaggtagggttaaaaattta
tatgatgcagaaggcaataaaatatcttattatcaagtaaatgctacttattttagtgct
ttaaatgaagatgaaactaagcttttaattgcaagagcaattcaaatgtttatgcctgga
attcctcaagtttggtatttagatttatttgcaggtaaaaatgattatgaagctgcagac
aaagcaggaagtggaggtcataaagaaattaatagaactaacttatccttagatcaaatc
aacataggtttgcaaaaagaggtcgttttaaaacaactagacctaattcgatttagaaat
acatctaacgtattttcaggaacaataaatataaattcaaaaagtgatgatgtaatagat
attacttggtctttagcaaacgaaaaagcctctctatatataaatctaaatactttagag
ttaagggtaaatcataatgataaagaagggcttataacatctattatttag

DBGET integrated database retrieval system