KEGG   Polaribacter sp. MED152: MED152_05365Help
Entry
MED152_05365      CDS       T02533                                 

Gene name
folE3
Definition
GTP cyclohydrolase I (EC:3.5.4.16)
Orthology
K01495  
GTP cyclohydrolase I [EC:3.5.4.16]
Organism
pom  Polaribacter sp. MED152
Pathway
Folate biosynthesis
Metabolic pathways
Class
Metabolism; Metabolism of cofactors and vitamins; Folate biosynthesis [PATH:pom00790]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1200483..1201181
Genome map
AA seq 232 aa AA seqDB search
MITDVILKEKQTDQKLNGFSFEEVGDDHLFTGLETPMKKDAFKLSDQEKKEKIAILFEEI
MDVMGLDLTDDSLQGTPKRVAKMYIDEIFSGLNPANKPKVALFDNKYKYNQMLVEKNITF
YSNCEHHFVPIIGKAHVAYISSGKVIGLSKLNRIVQYYAKRPQVQERLTNQIAEELKGIL
GTEDVAVIIDAKHLCVSSRGIKDDTSATVTSYFGGKFNNQEKIAELQNTLNY
NT seq 699 nt NT seq  +upstreamnt  +downstreamnt
atgattacagatgtaatacttaaagaaaagcaaacagaccaaaaattaaatggtttttca
ttcgaagaagtaggtgatgatcatctatttacaggtttagaaaccccaatgaaaaaagat
gcttttaaactttctgatcaagaaaagaaagaaaaaattgctatcctttttgaagaaatt
atggatgtaatgggcctagaccttacagacgattctttacaaggcactccaaaaagagtt
gcaaaaatgtatattgatgaaattttttctggcttaaaccctgcaaacaagccaaaagtt
gccttatttgataacaaatacaaatacaaccaaatgttggttgaaaagaatataactttt
tactctaactgtgagcatcactttgtaccaattattggtaaagcacatgtagcttacatt
tcttctggtaaagttattggtttatctaaattaaacagaattgtacagtattatgcaaaa
agacctcaagtgcaagaaaggttaacaaaccaaattgcagaagagctaaaaggcatttta
ggtacagaagatgttgctgttattatagatgctaagcatttatgtgtatcttctagagga
attaaagacgatacctcagctacagttacctcatactttggaggtaaattcaacaatcaa
gaaaaaatagcagaattacaaaacactttaaattattag

DBGET integrated database retrieval system