KEGG   Polaribacter sp. MED152: MED152_05875Help
Entry
MED152_05875      CDS       T02533                                 

Gene name
glgB
Definition
1,4-alpha-glucan branching enzyme (EC:2.4.1.18)
Orthology
K00700  
1,4-alpha-glucan branching enzyme [EC:2.4.1.18]
Organism
pom  Polaribacter sp. MED152
Pathway
Starch and sucrose metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Class
Metabolism; Carbohydrate metabolism; Starch and sucrose metabolism [PATH:pom00500]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1324832..1326739
Genome map
AA seq 635 aa AA seqDB search
MAKTKVHSLFTEFDIDLFKAGKHYRLYEKFGSHIITVDNEVGTYFAVWAPSAKMVSVIGD
FNYWLGDEHQLNVRWDGSGIWEGFIPGVQKGATYKYRIENSDNNTRTEKADPFARRCEHP
PKTASQVWDDNYQWKDKNWMQNRKKNNALDAPFSVYEVHLGSWKKQVEENRFLSYIELAD
ELVAYVKEMNFTHVEFMPIMEYPYDPSWGYQLTGYFAPTSRFGYPDEFKQLVDTFHENGI
GVLLDWVPSHFPSDDHGLGFFDGSHLYEHPDRRKGYHQDWKSLIFNYGRNEIKAFLISNA
IFWLDHYHADGLRVDAVASMLFLDYSREEGQWEPNIYGGREYLEAIDFIKDMNAAVYEAF
PDVQTIAEESTSFPKVSRPIYDGGLGFGMKWMMGWMHDTLGYFQKEPIYRKHHQNELTFG
LNYAFSENFMLPLSHDEVVYGKNSIVDKMPGDEWQKFANLRLLYSFMYTHPGTKLLFQGG
EFGQTSEWNFEGSLDWHLLNYEVHKGAQTLVKDLNKLYKTEPALFEKQFSHEGFEWIDHS
DHQNSVMTYVRKGNKEKDNLLVILNFTPIPRNDYRIGLPKKGTLIEVFNSDAKKYNGTGD
FETSNLTSDAKEWNGRENSIAINLPPLAMLAFKYK
NT seq 1908 nt NT seq  +upstreamnt  +downstreamnt
atggcaaaaacaaaagtacacagtcttttcacagaatttgatatagatctttttaaggct
ggtaaacattatagattatacgaaaaatttggatcgcacattatcactgttgataatgaa
gtaggtacttattttgctgtttgggctccaagtgcaaaaatggtttctgttattggtgat
ttcaactattggttgggagatgagcatcaattaaatgtaagatgggatggtagtggaatt
tgggaaggctttataccaggtgtacaaaaaggtgctacttataaatatagaatagaaaat
tctgacaacaatacaagaacagaaaaagcagatccatttgcaagaagatgtgaacatcct
cctaaaactgcatcgcaagtttgggatgataattaccaatggaaagataaaaattggatg
cagaacagaaagaaaaacaatgcattagacgcaccattttctgtttatgaagttcactta
ggctcttggaaaaaacaagtagaagagaatagatttttaagttatatagagctagcagat
gaactagttgcctatgtaaaagagatgaattttactcatgtagaatttatgccaattatg
gaatatccttacgatccaagttggggatatcaactcacaggttattttgcacccacttca
cgttttggatatccagatgaatttaaacaattggtagacacttttcacgaaaatggaatt
ggagtattattggattgggttccctctcactttccttcagatgatcatggtttaggcttt
tttgatgggtctcatttatacgaacatccagatagaagaaaaggctatcatcaagattgg
aaaagtttaatttttaattatggtagaaatgaaataaaggcttttttaattagtaatgct
atcttttggttagatcattatcatgcagatggtttaagagtagatgcagtagcatcaatg
ttatttttagattattctagagaagagggccaatgggaaccaaatatttatggaggaaga
gaatatttagaggctatagattttataaaggatatgaatgctgcagtctatgaagctttt
ccagatgtacaaaccattgcagaagaatctacttcttttccaaaagtttccagaccaatt
tatgatggtggattaggctttggtatgaaatggatgatgggttggatgcacgatacttta
ggctactttcagaaagaacctatttacagaaaacatcatcaaaatgaattaacttttggg
ttaaattatgccttctcagaaaattttatgcttcctctttcacatgatgaagtagtatat
ggtaaaaattctattgtagataaaatgccaggagatgaatggcaaaagtttgcaaatctt
cgtttactttatagttttatgtacacacatcctggaaccaaattattatttcaagggggt
gaatttggtcaaacttcagaatggaattttgaaggtagtttagactggcatttactaaat
tatgaggtgcataaaggtgctcaaaccctagtaaaagatttaaacaagctatacaaaaca
gaacctgccttattcgaaaaacaattcagtcatgaaggttttgagtggatagatcattca
gatcatcaaaactctgttatgacttatgttagaaaaggtaataaagaaaaagataatcta
ctagttattttaaactttacaccaattcctagaaatgactatagaataggtttgccaaaa
aaggggactcttatagaggtctttaatagtgatgcaaaaaaatacaatggtacaggagat
tttgaaacaagtaatttaacttcagacgctaaagaatggaatggtagagaaaactcaatt
gccattaacttgcctcctctagctatgcttgcatttaaatacaaataa

DBGET integrated database retrieval system