KEGG   Polaribacter sp. MED152: MED152_07745Help
Entry
MED152_07745      CDS       T02533                                 

Gene name
tdk
Definition
thymidine kinase (EC:2.7.1.21)
Orthology
K00857  
thymidine kinase [EC:2.7.1.21]
Organism
pom  Polaribacter sp. MED152
Pathway
Pyrimidine metabolism
Metabolic pathways
Class
Metabolism; Nucleotide metabolism; Pyrimidine metabolism [PATH:pom00240]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1738251..1738910
Genome map
AA seq 219 aa AA seqDB search
MFLENTVNHTEQFGWIEVICGSMFSGKTEELIRRLKRAQFAKQRVEIFKPAVDTRYDEEE
VVSHNDSRIRSTPVPVSSNIRLLANDVDVVGIDEAQFFDDEIVAVCNDLANRGVRVIVAG
LDMDFKGKPFGPMPALMATAEYVTKVHAVCTHTGNLAHYSFRKAQNDNLVMLGETQEYEP
LSRAAYYKAVKEKEQLTSVEASNNSDIDTSKTDLNSTQE
NT seq 660 nt NT seq  +upstreamnt  +downstreamnt
atgtttcttgaaaatactgtaaatcatacagaacaatttggttggattgaggtaatttgt
ggctctatgttttctggtaaaacagaagagttaattaggcgtttaaaacgtgctcaattt
gcaaaacagcgtgtagaaatttttaaacctgctgttgatacaaggtatgatgaggaagaa
gtggtttctcataacgattctagaattcgttctacgcctgtacctgtttcttcaaatatt
cgtttgttagccaatgatgtagatgttgttggtattgatgaagctcagttttttgatgat
gaaattgttgctgtttgcaatgatttagccaatagaggagttcgtgtaatagttgctggt
ttagatatggattttaaaggtaaaccttttggcccaatgccagcactaatggctactgca
gagtatgttactaaagtgcatgcagtgtgcactcatacaggtaatttagctcattatagt
tttagaaaagcacaaaatgacaacttggttatgcttggcgaaacccaagaatatgaacca
ttaagcagagctgcttattacaaagctgttaaagaaaaagaacaacttacctctgttgaa
gctagcaataattcagatatcgatacttctaaaaccgatttaaattcaacgcaagaatga

DBGET integrated database retrieval system