KEGG   Pongo abelii (Sumatran orangutan): 100171486Help
Entry
100171486         CDS       T01416                                 

Gene name
GPX3
Definition
glutathione peroxidase 3 (plasma)
Orthology
K00432  
glutathione peroxidase [EC:1.11.1.9]
Organism
pon  Pongo abelii (Sumatran orangutan)
Pathway
Glutathione metabolism
Arachidonic acid metabolism
Thyroid hormone synthesis
Class
Metabolism; Lipid metabolism; Arachidonic acid metabolism [PATH:pon00590]
Metabolism; Metabolism of other amino acids; Glutathione metabolism [PATH:pon00480]
Organismal Systems; Endocrine system; Thyroid hormone synthesis [PATH:pon04918]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
5
AA seq 226 aa AA seqDB search
MARLLQASCLLSLLLAGFVPQSRGQEKSKMDCHGGISGTIYEYGALTIDGEEYIPFKQYA
GKYVLFVNVASYUGLTGQYIELNALQEELAPFGLVILGFPCNQFGKQEPGENSEILPTLK
YVRPGGGFVPNFQLFEKGDVNGEKEQKFYTFLKNSCPPTSELLGTSDRLFWEPMKVHDIR
WNFEKFLVGPDGIPIMRWHHRTTVSNVKMDILSYMRRQAALGVKRK
NT seq 681 nt NT seq  +upstreamnt  +downstreamnt
atggcccggctgctgcaggcgtcctgcctgctttccctgcttctggccggcttcgtcccg
cagagccggggacaagagaagtcgaagatggactgccatggtggcataagtggcaccatt
tacgagtacggagccctcaccattgatggggaggagtacatccccttcaagcagtacgct
ggcaaatacgtcctctttgtcaacgtggccagctactgaggcctgacgggccagtacatt
gaactgaatgcactacaggaggagcttgcaccattcggtctcgtcattctgggctttccc
tgcaaccaatttggaaaacaggaaccaggagagaactcagagatccttcccaccctcaag
tatgtccgaccaggtggaggctttgtccctaatttccagctctttgagaaaggggatgtc
aatggagagaaagagcagaaattctacacttttctaaagaactcctgtcctcccacctcg
gagctcctgggtacatctgaccgcctcttctgggaacccatgaaggttcacgacatccgc
tggaactttgagaagttcctggtggggccagatggtatacctatcatgcgctggcaccac
cggaccacggtcagcaacgtcaagatggacatcctgtcctacatgaggcggcaggcagcc
ctgggggtcaagaggaagtaa

DBGET integrated database retrieval system