KEGG   Pongo abelii (Sumatran orangutan): 100171490Help
Entry
100171490         CDS       T01416                                 

Gene name
AR
Definition
androgen receptor
Orthology
K08557  
androgen receptor
Organism
pon  Pongo abelii (Sumatran orangutan)
Pathway
Oocyte meiosis
Pathways in cancer
Prostate cancer
Brite
KEGG Orthology (KO) [BR:pon00001]
 Cellular Processes
  Cell growth and death
   04114 Oocyte meiosis
    100171490 (AR)
 Human Diseases
  Cancers
   05200 Pathways in cancer
    100171490 (AR)
   05215 Prostate cancer
    100171490 (AR)
Transcription factors [BR:pon03000]
 Eukaryotic Type
  Zinc finger
   Cys4 estrogen-like
    100171490 (AR)
Nuclear receptors [BR:pon03310]
 3. Estrogen like
  3C. 3-Ketosteroid receptor
   100171490 (AR)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Ensembl: 
UniProt: 
Position
X
AA seq 388 aa AA seqDB search
MILWLHSLETARDHVLPIDYYFPPQKTCLICGDEASGCHYGALTCGSCKVFFKRAAEGKQ
KYLCASRNDCTIDKFRRKNCPSCRLRKCYEAGMTLGARKLKKLGNLKLQEEGEASSTTSP
TEETTQKLTVSHIEGYECQPIFLNVLEAIEPGVVCAGHDNNQPDSFAALLSSLNELGERQ
LVHVVKWAKALPGFRNLHVDDQMAVIQYSWMGLMVFAMGWRSFTNVNSRMLYFAPDLVFN
EYRMHKSRMYSQCVRMRHLSQEFGWLQITPQEFLCMKALLLFSIIPVDGLKNQKFFDELR
MNYIKELDRIIACKRKNPTSCSRRFYQLTKLLDSVQPIARELHQFTFDLLIKSHMVSVDF
PEMMAEIISVQVPKILSGKVKPIYFHTQ
NT seq 1167 nt NT seq  +upstreamnt  +downstreamnt
atgatactctggcttcacagtttggagactgccagggaccatgttttgcccattgactat
tactttccaccccagaagacctgcctgatctgtggagacgaagcttctgggtgtcactat
ggagctctcacatgtggaagctgcaaggtcttcttcaaaagagccgctgaagggaaacag
aagtacctgtgtgccagcagaaatgattgcactattgataaattccgaaggaaaaattgt
ccatcttgtcgtcttcggaaatgttatgaagcagggatgactctgggagcccgaaagctg
aagaaacttggtaatctgaaactacaggaggaaggagaggcttccagcaccaccagcccc
actgaggagacaacccagaagctgacagtgtcacacattgaaggctatgaatgtcagccc
atctttctgaatgtcctggaagccattgagccaggtgtagtgtgtgctggacacgacaac
aaccagcccgactcctttgcagccttgctctctagcctcaatgaactgggagagagacag
cttgtacacgtggtcaagtgggccaaggccttgcctggtttccgcaacttacacgtggac
gaccagatggctgtcattcagtactcctggatgggactcatggtgtttgccatgggctgg
cgatccttcaccaatgtcaactccaggatgctctacttcgcccctgatctggttttcaat
gagtaccgcatgcacaagtcccggatgtacagccagtgtgtccgaatgaggcacctctct
caagagtttggatggctccaaatcaccccccaggaattcctgtgcatgaaagcactgcta
ctcttcagcattattccagtggatgggctgaaaaatcaaaaattctttgatgaacttcga
atgaactacatcaaggaactcgatcgtatcattgcatgcaaaagaaaaaatcccacatcc
tgctcaagacgcttctaccagctcaccaagctcctggactccgtgcagcctattgcgaga
gagctgcatcagttcacttttgacctgctaatcaagtcacacatggtgagcgtggacttt
ccggaaatgatggcagagatcatctctgtgcaagtgcccaagatcctttctgggaaagtc
aagcccatctatttccacacccagtga

DBGET integrated database retrieval system