KEGG   Pongo abelii (Sumatran orangutan): 100171521Help
Entry
100171521         CDS       T01416                                 

Gene name
UGT2B7
Definition
(RefSeq) UDP-glucuronosyltransferase 2B7 precursor
  KO
K00699  glucuronosyltransferase [EC:2.4.1.17]
Organism
pon  Pongo abelii (Sumatran orangutan)
Pathway
pon00040  Pentose and glucuronate interconversions
pon00053  Ascorbate and aldarate metabolism
pon00140  Steroid hormone biosynthesis
pon00830  Retinol metabolism
pon00860  Porphyrin and chlorophyll metabolism
pon00980  Metabolism of xenobiotics by cytochrome P450
pon00982  Drug metabolism - cytochrome P450
pon00983  Drug metabolism - other enzymes
pon01100  Metabolic pathways
pon05204  Chemical carcinogenesis
Module
pon_M00014  Glucuronate pathway (uronate pathway)
Brite
KEGG Orthology (KO) [BR:pon00001]
 Metabolism
  Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    100171521 (UGT2B7)
   00053 Ascorbate and aldarate metabolism
    100171521 (UGT2B7)
  Lipid metabolism
   00140 Steroid hormone biosynthesis
    100171521 (UGT2B7)
  Metabolism of cofactors and vitamins
   00830 Retinol metabolism
    100171521 (UGT2B7)
   00860 Porphyrin and chlorophyll metabolism
    100171521 (UGT2B7)
  Xenobiotics biodegradation and metabolism
   00980 Metabolism of xenobiotics by cytochrome P450
    100171521 (UGT2B7)
   00982 Drug metabolism - cytochrome P450
    100171521 (UGT2B7)
   00983 Drug metabolism - other enzymes
    100171521 (UGT2B7)
 Human Diseases
  Cancers
   05204 Chemical carcinogenesis
    100171521 (UGT2B7)
Enzymes [BR:pon01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.17  glucuronosyltransferase
     100171521 (UGT2B7)
Glycosyltransferases [BR:pon01003]
 Others
  Hydrophobic molecule
   100171521 (UGT2B7)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: UDPGT Glyco_tran_28_C Glyco_transf_4 Glyco_trans_4_4
Motif
Other DBs
NCBI-GeneID: 100171521
NCBI-ProteinID: NP_001124675
Ensembl: ENSPPYG00000014786
UniProt: Q5RFA8
Position
4
AA seq 529 aa AA seqDB search
MSMKWSSVILLIQLSFYFSSGNCGKVLVWAAEYSHWMNIKTILDELVQRGHEVTVLASSA
SILFDPNNSSALKIEIYPTSLTKTELENFIVQQINRWSDLPKDTFWLYFSQVQEIMSTFG
DITRKFCEDIVSNKKFMKKVQESRFDIIFADAIFPCSELLAELFNIPFVYSLSFSPGYTF
EKHSGGFIFPPSYVPVVMSELTDQMTFMERVKNMIYVLYFDFWFQIFDMNKWDQFYSEVL
GRPTTLFETMGKADIWLIRNSWNFQFPHPLLPNVDFVGGLHCKPAKPLPKEMEEFVQSSG
ENGVVVFSLGSMVSNMKEERANVIASALAQIPQKVLWRFDGNKPDTLGLNTRLYKWIPQN
DLLGHPKTRAFITHGGANGIYEAIYHGIPMVGIPLFADQPDNIAHMKAKGAALKLDFNTM
SSTDLLNALKTVINDPLYKENVMKLSRIQHDQPVKPLDRAVFWIEFVMRHKGAKHLRVAA
HDLTWFQYHSLDVIGFLLACVATVIFIITKCCLFCFWKFTRKTKKGKND
NT seq 1590 nt NT seq  +upstreamnt  +downstreamnt
atgtctatgaaatggagttcagtaattttgctaatacaactgagcttttactttagctct
gggaattgtggaaaggtgctggtgtgggcagcagaatatagccattggatgaatataaag
acaatcctggatgaacttgttcagagaggtcatgaggtgactgtactggcatcttcagct
tccattctttttgatcccaacaactcatccgctcttaaaattgaaatctatcccacatct
ttaactaaaactgagttggagaatttcatcgttcaacagattaacagatggtcagacctt
ccaaaagatacattttggttatatttttcacaagtacaggaaatcatgtcgacatttggt
gacataactagaaagttctgtgaagatatagtttcaaataagaaatttatgaaaaaagta
caagagtcaagatttgacatcatttttgcagatgctatttttccctgcagtgagctgctg
gctgagctatttaacataccctttgtgtacagtctcagcttctctcctggctacactttt
gaaaagcatagtggaggatttattttccctccttcctacgtacctgttgttatgtcagaa
ttaactgatcaaatgactttcatggagagggtaaaaaatatgatctatgtgctttatttt
gacttttggttccaaatatttgacatgaataagtgggatcagttttatagtgaagttcta
ggaagacccactaccttatttgagacaatggggaaagctgacatatggcttattcgaaac
tcctggaattttcagtttccacatccactcttaccaaatgttgattttgttggaggactc
cactgcaaacctgccaaacccctgcctaaggaaatggaagagtttgtacagagctctgga
gaaaatggtgttgtggtgttttctctggggtcaatggtcagtaacatgaaagaagaaagg
gccaacgtaattgcatcagcccttgcccagatcccacaaaaggttctgtggagatttgat
gggaataaaccagataccttaggtctcaatactcggctctacaagtggataccccagaat
gaccttctaggtcatccaaaaaccagagcttttataactcacggtggagccaatggcatc
tacgaggcaatctaccatgggatccctatggtgggcattccattgtttgccgatcaacct
gacaacattgctcacatgaaggccaagggagcagctcttaaattggacttcaatacaatg
tcgagtacagacttgctgaatgcattgaagacagtaattaatgatcctttatataaagag
aatgttatgaaattatcaagaattcaacatgatcaaccagtgaagcccctggatcgagca
gtcttctggattgaatttgtcatgcgccacaaaggagctaaacaccttcgggttgcagcc
cacgacctcacctggttccagtaccactctttggacgtgattgggttcctgctggcctgt
gtggcaactgtgatatttatcatcacaaaatgttgtctgttttgtttctggaagtttact
agaaaaacaaagaagggaaaaaatgattag

DBGET integrated database retrieval system