KEGG   Pongo abelii (Sumatran orangutan): 100171527Help
Entry
100171527         CDS       T01416                                 

Gene name
RAE1, MRNP41
Definition
RAE1 RNA export 1 homolog (S. pombe)
Orthology
K14298  
mRNA export factor
Organism
pon  Pongo abelii (Sumatran orangutan)
Pathway
RNA transport
Influenza A
Module
Nuclear pore complex
Brite
KEGG Orthology (KO) [BR:pon00001]
 Genetic Information Processing
  Translation
   03013 RNA transport
    100171527 (RAE1)
 Human Diseases
  Infectious diseases
   05164 Influenza A
    100171527 (RAE1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Ensembl: 
UniProt: 
Position
20
AA seq 368 aa AA seqDB search
MSLFGTTSGFGTSGTSMFGSATTDNHNPMKDIEVTSSPDDSIGCLSFSPPTLPGNFLIAG
SWANDVRCWEVQDSGQTIPKAQQMHTGPVLDVCWSDDGSKVFTASCDKTAKMWDLSSNQA
IQIAQHDAPVKTIHWIKAPNYSCVMTGSWDKTLKFWDTRSSNPMMVLQLPERCYCADVIY
PMAVVATAERGLIVYQLENQPSEFRRIESPLKHQHRCVAIFKDKQNKPTGFALGSIEGRV
AIHYINPPNPAKDNFTFKCHRSNGTNTSAPQDIYAVNGIAFHPVHGTLATVGSDGRFSFW
DKDARTKLKTSEQLDQPISACCFNHNGNIFAYASSYDWSKGHEFYNPQKKNYIFLRNAAE
ELKPRNKK
NT seq 1107 nt NT seq  +upstreamnt  +downstreamnt
atgagcctgtttggaacaacctcaggttttggaaccagtgggaccagcatgtttggcagc
gcaaccacagacaatcacaatcctatgaaggatattgaagtaacatcatctcctgatgat
agcattggttgtctatcttttagcccaccaaccttgccggggaactttcttattgcagga
tcatgggctaatgatgttcgctgctgggaagttcaagacagtggacagactattccaaaa
gcccaacagatgcacactgggcctgtgctcgatgtctgctggagtgacgatgggagcaaa
gtatttacggcatcgtgtgataaaactgccaaaatgtgggacctcagcagtaaccaagcg
atacagattgcacagcatgatgctcctgttaaaaccatccattggatcaaagctccaaac
tacagctgtgtgatgactgggagctgggataagactttaaagttttgggatactcgatcg
tcaaatcctatgatggttttgcaactccctgaaaggtgttactgtgctgacgtgatatac
cccatggctgtggtggcaactgcagagaggggcctgattgtctatcagctagagaatcaa
ccttctgaattcaggaggatagaatctccactgaaacatcagcatcggtgtgtggctatt
tttaaagacaaacagaacaagcctactggttttgccctgggaagtatcgaggggagagtt
gctattcactatatcaaccccccgaaccccgccaaagataacttcacctttaaatgtcat
cgatctaatggaaccaacacttcagctcctcaggacatttatgcggtcaatggaatcgcc
ttccatcctgttcatggcacccttgcaactgtgggatctgatggtagattcagcttctgg
gacaaagatgccagaacaaaactaaaaacttcggaacagttagatcagcccatctcagcc
tgctgtttcaatcacaatggaaacatatttgcgtacgcttccagctacgactggtcaaag
ggacatgaattttataatccccagaaaaaaaattacattttcctgcgtaatgcagccgaa
gagctaaagcccaggaataagaagtag

DBGET integrated database retrieval system