KEGG   Pongo abelii (Sumatran orangutan): 100171568Help
Entry
100171568         CDS       T01416                                 

Gene name
DAO
Definition
D-amino-acid oxidase (EC:1.4.3.3)
Orthology
K00273  
D-amino-acid oxidase [EC:1.4.3.3]
Organism
pon  Pongo abelii (Sumatran orangutan)
Pathway
Glycine, serine and threonine metabolism
Arginine and proline metabolism
D-Arginine and D-ornithine metabolism
Metabolic pathways
Peroxisome
Brite
KEGG Orthology (KO) [BR:pon00001]
 Metabolism
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    100171568 (DAO)
   00330 Arginine and proline metabolism
    100171568 (DAO)
  Metabolism of other amino acids
   00472 D-Arginine and D-ornithine metabolism
    100171568 (DAO)
  Biosynthesis of other secondary metabolites
   00311 Penicillin and cephalosporin biosynthesis
    100171568 (DAO)
 Cellular Processes
  Transport and catabolism
   04146 Peroxisome
    100171568 (DAO)
Enzymes [BR:pon01000]
 1. Oxidoreductases
  1.4  Acting on the CH-NH2 group of donors
   1.4.3  With oxygen as acceptor
    1.4.3.3  D-amino-acid oxidase
     100171568 (DAO)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
12
AA seq 123 aa AA seqDB search
MHVVVIGAGVIGLSTALCIHERYHSVLQPLDIKVYADRFTPLTTTDVAAGFWQPYLSDPS
NPQEADWSQQTFDYLLSHVHSPNAEELGLFLISGYNLFHEAIPLWLVPHKPNSGGKELST
VAD
NT seq 372 nt NT seq  +upstreamnt  +downstreamnt
atgcatgtggtggtgattggagcaggagtcatcgggctgtccaccgccctctgcatccat
gagcgctaccactcagtcctgcagccactggacataaaggtctacgcagaccgcttcacc
ccactcaccaccaccgacgtggctgccggcttctggcagccctacctttctgaccccagc
aacccacaggaggcggactggagccaacagacttttgactatctcctgagccatgtccat
tctcccaacgctgaagaactgggcctgttcctaatctcgggttacaaccttttccatgaa
gccattccgctatggctggttccacacaagcctaattctggagggaaagaactatctaca
gtggctgactga

DBGET integrated database retrieval system