KEGG   Pongo abelii (Sumatran orangutan): 100171586Help
Entry
100171586         CDS       T01416                                 

Gene name
MIPEP
Definition
(RefSeq) mitochondrial intermediate peptidase
  KO
K01410  
mitochondrial intermediate peptidase [EC:3.4.24.59]
Organism
pon  Pongo abelii (Sumatran orangutan)
Brite
Enzymes [BR:pon01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.24  Metalloendopeptidases
    3.4.24.59  mitochondrial intermediate peptidase
     100171586 (MIPEP)
Peptidases [BR:pon01002]
 Metallo Peptidases
  Family M3
   100171586 (MIPEP)
Mitochondrial biogenesis [BR:pon03029]
 Mitochondrial protein import machinery
  Matrix
   Other matrix factors
    100171586 (MIPEP)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GeneID: 
NCBI-ProteinID: 
UniProt: 
Position
13
AA seq 713 aa AA seqDB search
MLCVGRLGGLGARAAALPPRRAGRGILEAGIRARRVSTSWSPVGAAFNVKPQGSRLDLFG
ERRGLFGVPELSAPEGFHAAQEKALRKAELLVGRACSTPPGPQTVLIFDELSDSLCRVAD
LADFVKIAHPEPAFREAAEEACRSIGTMVEKLNTNVDLYQSLRKLLADKKLVDSLDPETR
RVAELFMFDFEISGIHLDKEKRKRAVDLNVKILDLSSTFLMGANFPNKIEKHLLPEHIRR
NFTSAGDHIIIDGLHAESPDDLVREAAYKIFLYPNAGQLKCLEELLSSRDLLAKLVGYST
FSHRALQGTIAKNPETVMQFLEKLSDKLSERTLKDFEMIRGMKMKLNPQNSEVMPWDPPY
YSGVIRAERYNIEPSLYCPFFSLGACMEGLNILLNRLLGISLYAEQPAKGEVWSEDVRKL
AVVHESEGLLGYIYCDFFQRADKPHQDCHFTIRGGRLKEDGDYQLPVVVLMLNLPRSSRS
SPTLLTPGMMENLFHEMGHAMHSMLGRTRYQHVTGTRCPTDFAEVPSILMEYFANDYRVV
NQFARHYQTGQPLPKNMVSRLCESKKVCAAADMQLQVFYATLDQIYHGKHPLRNSTTDIL
KETQEKFYGLPYVPDTAWQLRFSHLVGYGAKYYSYLMSRAVASMVWKECFLQDPFNRAAG
ERYRREMLAHGGGREPMLMVEGMLQKCPSVDDFVSALVSDLDLDFETFLMDSE
NT seq 2142 nt NT seq  +upstreamnt  +downstreamnt
atgctgtgcgtcggaaggctgggcggcttgggagccagagcagcagctctgccgccccgg
cgggcgggccggggaatcctcgaagccgggatccgggcccgaagggtcagcaccagctgg
tctcccgtgggcgccgccttcaatgtcaagccccagggcagccgcttggacctgttcggc
gagcgccggggtctttttggagttcctgagctgagtgccccggaaggatttcatgctgca
caagaaaaagccttgagaaaggcagaattgcttgtgggccgtgcgtgttccaccccacct
gggccccagaccgtgctgatcttcgatgagctctcggattccttgtgcagagtggccgac
ttggctgattttgtgaaaatcgctcaccctgagccagcattcagagaagctgcggaagaa
gcttgtagaagtattggcaccatggtggagaagttgaacacaaatgtggatttatatcaa
agtttgcgaaaattactagctgataaaaaacttgtggattcccttgatccagaaacaagg
cgagtggctgaactgtttatgtttgattttgaaattagtggaatccatctagacaaagaa
aagcgtaaaagagcagtggacctcaatgttaaaatcttggatttgagtagtacatttctt
atgggagccaattttcccaacaagattgagaagcatctcttaccagaacacattcgtcgt
aactttacatctgctggggatcatatcataattgatggtctccacgcagaatcgccagat
gacttggtgcgagaagctgcttataaaatttttctttaccccaatgctggtcaattgaaa
tgtttagaagaattgctcagcagcagagatcttctggcaaagttggtggggtattccacg
ttttctcacagggctctccaaggaacgatagctaaaaatccagagactgtcatgcagttc
cttgaaaaactatctgacaaactttctgaaagaactctaaaagattttgagatgatacga
gggatgaaaatgaaactgaatcctcaaaattccgaagtaatgccttgggaccccccctac
tacagtggtgtgattcgtgcagaaaggtataatattgagcccagcctatattgcccgttt
ttctctcttggagcgtgcatggaaggcctgaatattttgcttaacagactgttggggatt
tcattatatgcggagcagcctgcaaaaggagaggtgtggagcgaagatgtccgaaaactg
gctgtcgttcatgaatctgaaggattgttggggtacatttactgtgatttttttcagcga
gcagacaaaccacatcaggattgccatttcactatccgtggaggcagactaaaggaagat
ggagactatcaactcccagttgtagttcttatgctgaatcttccccgttcctcaaggagt
tctccaactttgctaactcctggcatgatggaaaatcttttccatgaaatgggacatgcc
atgcattcaatgctaggacgtactcgttaccaacacgtcactgggaccaggtgccctact
gattttgctgaggttccttctattctgatggagtactttgcaaatgattatcgagtagtt
aaccaatttgccagacattatcagactggacagccactgccaaaaaatatggtgtctcgt
ctttgtgaatctaaaaaggtttgtgctgcagctgatatgcaacttcaggtcttttatgcc
actctggatcaaatctaccatgggaagcatcccctgaggaattcaaccacagacattctc
aaggaaacacaagagaaattctatggcctaccatacgttccagatactgcctggcagctg
cgattcagccacctcgtggggtatggtgctaaatattactcttacctcatgtccagagcg
gtcgcctccatggtttggaaggagtgttttctacaggatcctttcaacagggctgccggg
gagcgctatcgcagggagatgctggcccacggtggaggcagggagcccatgctcatggtt
gaaggtatgcttcagaagtgtccttctgttgatgacttcgtaagtgccctcgtttctgac
ttggatctggacttcgaaactttcctcatggattctgaataa

DBGET integrated database retrieval system