KEGG   Pongo abelii (Sumatran orangutan): 100171597Help
Entry
100171597         CDS       T01416                                 

Gene name
SHMT2
Definition
serine hydroxymethyltransferase 2 (mitochondrial) (EC:2.1.2.1)
Orthology
K00600  
glycine hydroxymethyltransferase [EC:2.1.2.1]
Organism
pon  Pongo abelii (Sumatran orangutan)
Pathway
Glycine, serine and threonine metabolism
Cyanoamino acid metabolism
Glyoxylate and dicarboxylate metabolism
One carbon pool by folate
Metabolic pathways
Carbon metabolism
Biosynthesis of amino acids
Module
C1-unit interconversion, eukaryotes
Class
Metabolism; Overview; Carbon metabolism [PATH:pon01200]
Metabolism; Overview; Biosynthesis of amino acids [PATH:pon01230]
Metabolism; Carbohydrate metabolism; Glyoxylate and dicarboxylate metabolism [PATH:pon00630]
Metabolism; Amino acid metabolism; Glycine, serine and threonine metabolism [PATH:pon00260]
Metabolism; Metabolism of other amino acids; Cyanoamino acid metabolism [PATH:pon00460]
Metabolism; Metabolism of cofactors and vitamins; One carbon pool by folate [PATH:pon00670]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
12
AA seq 504 aa AA seqDB search
MLYFSLFWAARPLQRCGQLVRMAIRAQHSNAAQTQTGEANRGWTGQESLSDSDPEMWELL
QREKDRQCRGLELIASENFCSRAALEALGSCLNNKYSEGYPGKRYYGGAEVVDEIELLCQ
RRALEAFDLDPAQWGVNVQPYSGSPANLAVYTALLQPHDRIMGLDLPDGGHLTHGYMSDV
KRISATSIFFESMPYKLNPKTGLIDYDQLALTARLFRPRLIIAGTSAYARLIDYNRMREV
CDEVKAHLLADMAHISGLVAAQVIPSPFKHADVVTTTTHKTLRGARSGLIFYRKGVKAVD
PKTGREIPYTFEDRINFAVFPSLQGGPHNHAIAAVAVALKQACTPMFREYSLQVLKNARA
MADALLERGYSLVSGGTDNHLVLVDLRPKGLDGARAERVLELVSITANKNTCPGDRSAIT
PGGLRLGAPALTSRQFREDDFRRVVDFIDEGVNIGLEVKRKTAKLQDFKSFLLKDSETSQ
RLADLRQRVEQFARAFPMPGFDEH
NT seq 1515 nt NT seq  +upstreamnt  +downstreamnt
atgctgtacttctctttgttctgggcggctcggcctctgcagagatgtgggcagctggtc
aggatggccattcgggctcagcacagcaacgcagcccagactcagactggggaagcaaac
aggggctggacaggccaggagagcctgtcggacagtgatcctgagatgtgggagttgcta
cagagggagaaggacaggcagtgtcgtggcctggagctcattgcctcagagaacttctgc
agccgagctgcgctggaggccctggggtcctgtctgaacaacaagtactcggagggttat
cctggcaagagatactatgggggagcagaggtggtggatgaaattgagctgctgtgccag
cgccgggccttggaagcctttgacctggatcctgcacagtggggagtcaatgtccagccc
tactccgggtccccagccaacctggccgtctatacagcccttctgcaacctcacgaccgg
atcatggggctggacctgcccgatgggggccatctcacccacggctacatgtctgacgtc
aagcggatatcagccacgtccatcttcttcgagtctatgccctataagctcaaccccaaa
actggcctcattgactatgaccagctggcactgactgctcgacttttccgaccgcggctc
atcatagctggcaccagcgcctatgctcgcctcattgactacaaccgcatgagagaggtg
tgtgatgaagtcaaagcacacctgctggcagacatggcccacatcagtggcctggtggct
gcccaggtgattccctcgcctttcaagcacgcagacgtcgtcaccaccactactcacaag
actcttcgaggggccaggtcagggctcatcttctaccggaaaggggtgaaggctgtggac
cccaagactggccgggagatcccttacacatttgaggaccgaatcaactttgccgtgttc
ccatccctgcaggggggcccccacaatcatgccattgctgcagtagctgtggccctaaag
caggcctgcacccccatgttccgggagtactccctgcaggttctgaagaatgctcgggcc
atggcagatgccctgctagagcgaggctactcactggtatcaggtggtactgacaaccac
ctggtgctggtggacctgcggcccaagggcctggatggagctcgggctgagcgggtgcta
gagcttgtatccatcactgccaacaagaacacctgtcctggagaccgaagtgccatcaca
ccggggggcctgcggcttggggccccggccttaacttctcgacagttccgtgaggatgac
tttcggagagttgtggactttatagatgaaggggtcaacattggcttagaggtgaagagg
aagactgccaagctccaggatttcaaatccttcctgctcaaggactcagaaacaagtcag
cgtctggccgacctcaggcaacgggtggagcagtttgccagggccttccccatgcctggt
tttgatgagcattga

DBGET integrated database retrieval system