KEGG   Pongo abelii (Sumatran orangutan): 100171640Help
Entry
100171640         CDS       T01416                                 

Gene name
PLCD4
Definition
(RefSeq) 1-phosphatidylinositol 4,5-bisphosphate phosphodiesterase delta-4
  KO
K05857  phosphatidylinositol phospholipase C, delta [EC:3.1.4.11]
Organism
pon  Pongo abelii (Sumatran orangutan)
Pathway
pon00562  Inositol phosphate metabolism
pon01100  Metabolic pathways
pon04020  Calcium signaling pathway
pon04070  Phosphatidylinositol signaling system
pon04919  Thyroid hormone signaling pathway
pon04933  AGE-RAGE signaling pathway in diabetic complications
Module
pon_M00130  Inositol phosphate metabolism, PI=> PIP2 => Ins(1,4,5)P3 => Ins(1,3,4,5)P4
Brite
KEGG Orthology (KO) [BR:pon00001]
 Metabolism
  Carbohydrate metabolism
   00562 Inositol phosphate metabolism
    100171640 (PLCD4)
 Environmental Information Processing
  Signal transduction
   04020 Calcium signaling pathway
    100171640 (PLCD4)
   04070 Phosphatidylinositol signaling system
    100171640 (PLCD4)
 Organismal Systems
  Endocrine system
   04919 Thyroid hormone signaling pathway
    100171640 (PLCD4)
 Human Diseases
  Endocrine and metabolic diseases
   04933 AGE-RAGE signaling pathway in diabetic complications
    100171640 (PLCD4)
Enzymes [BR:pon01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.4  Phosphoric-diester hydrolases
    3.1.4.11  phosphoinositide phospholipase C
     100171640 (PLCD4)
Membrane trafficking [BR:pon04131]
 Exocytosis
  Calcium ion-dependent exocytosis
   Phospholipases
    100171640 (PLCD4)
 Endocytosis
  Macropinocytosis
   Phospholipase C
    100171640 (PLCD4)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: PI-PLC-X PI-PLC-Y EF-hand_like EF-hand_10 C2 EF-hand_7 EF-hand_1 EF-hand_6 EF-hand_5 PH GDPD EF-hand_8 PH_12 Wap1
Motif
Other DBs
NCBI-GeneID: 100171640
NCBI-ProteinID: NP_001124787
Ensembl: ENSPPYG00000013177
UniProt: Q5RET0
Position
2B
AA seq 762 aa AA seqDB search
MASLLQDQLTTDQDLLLMQEGMPMRKVRSKSWKKLRYFRLQNDGMTVWHARQARGSAKPS
FSISDVDTIRNGHDSELLRSLAEELPLEQGFTVVFHGRRSNLDLVANSVEEAQMWMRGLQ
LLVDLVTSMDHQERLDQWLSDWFQRGDKNQDGKMSFQEVQRLLHLMNVEMDQEYAFSLFQ
AADTSQSGTLEGEEFVQFYKALTKRAEVQELFESFSADGQKLTLLEFLDFLREEQKERDC
TSELALELIDHYEPSDSGKLRHVLSMDGFLSYLCSKDGDIFNPACLPIYQDMTQPLNHYF
ICSSHNTYLVGDQLCGQSSVEGYIRALKRGCRCVEVDVWDGPSGEPVVYHGHTLTSRILF
KDVVATVAQYAFQTSDYPVILSLETHCSWEQQQTMARHLTEILGEQLLSTTLDGVLPTQL
PSPEELRRRILVKGKKLTLEEDLEYEEEEAEPELEESELALESQFETEPEPQEQNLQSKD
KKKKSKPILCPALSSLVIYLKSVSFRSFTHSKEHYHFYEISSFSETKAERLIKEAGNEFV
QHNTWQLSRVYPSGLRTDSSNYNPQELWNAGCQMVAMNMQTAGLEMDICDGHFRQNGGCG
YVLKPDFLRDIQSSFHPERPISPFKAQTLLIQVISGQQLPKVDKTKEGSIVDPLVKVQIF
GVRLDTARQETNYVENNGFNPYWGETLCFRVLVPELAMLRFVVMDYDWKSRNDFIGQYTL
PWTCMQQGYRHIHLLSKVGISLRPASIFVYICIQEDLEGDES
NT seq 2289 nt NT seq  +upstreamnt  +downstreamnt
atggcatccctgctgcaagaccagctgaccactgatcaggacttgctgctgatgcaggaa
ggcatgccgatgcggaaggtgaggtccaaaagctggaagaagctaagatacttcagactt
cagaatgacggcatgacagtctggcatgcacggcaggccaggggcagtgccaagcccagc
ttctcaatctctgatgtggacacaatacgtaatggccatgattccgagttgctgcgtagc
ctggcagaggagctccccctggagcagggcttcaccgttgtcttccatggccgccgctcc
aacctggacctggtggccaacagtgttgaggaggcccagatgtggatgcgagggctccag
ctgttggtggatcttgtcaccagcatggaccatcaggagcgcctggaccaatggctgagt
gactggtttcaacgtggagacaaaaatcaggatggtaagatgagtttccaagaagttcag
cggttattgcacctaatgaatgtggagatggaccaagaatatgccttcagtctttttcag
gcagcagacacgtcccagtctggaaccctggaaggagaagaattcgtacagttctataag
gcattgactaaacgtgctgaggtgcaggaactatttgaaagtttttcagctgatgggcag
aagctgactctgctggaatttttggatttcctccgagaggagcagaaggagagagactgc
acctctgagcttgctctggaactcattgaccactatgaaccttcagacagtggcaaactg
cggcatgtgctgagcatggatggcttcctcagctacctctgctctaaggatggagacatc
ttcaacccagcctgcctccccatctatcaggatatgactcaacccctgaaccactacttc
atctgctcttctcataacacctacctagtgggggaccagctttgtggccagagcagcgtc
gagggatatatacgggccctgaagcgggggtgccgctgcgtggaggtggatgtatgggat
ggacctagtggggaacctgtcgtttaccatggacacaccctgacctcccgcatcctgttc
aaagatgtcgtggccacagtagcacagtatgccttccagacgtcagactacccagtcatc
ttgtccctggagacccactgcagctgggagcagcagcagaccatggcccgccatctgact
gagatcctgggggagcagctgctgagcaccaccttggatggggtgctgcccactcagctg
ccctcacctgaggagcttcggaggaggatcctggtgaaggggaagaagttaacacttgag
gaagacctggaatatgaggaagaggaagcagagcctgagttggaggagtcagaattggca
ttggagtcccagtttgagactgagcctgagccccaggagcagaaccttcagagtaaggac
aaaaagaagaaatccaagcccatcttgtgtccagccctctcttccctggttatctacttg
aagtctgtctcattccgcagcttcacacattcaaaggagcactaccacttctacgagata
tcatctttctctgaaaccaaggccgagcgcctcatcaaggaggctggcaatgagtttgtg
cagcacaatacttggcagttaagccgtgtgtatcccagcggcctgaggacagactcttcc
aactacaacccccaggaactctggaatgcaggctgccagatggtggccatgaatatgcag
actgcagggcttgaaatggacatctgtgatgggcatttccgccagaatggtggctgtggc
tatgtgctgaagccagacttcctgcgtgatatccagagttccttccaccctgagaggccc
atcagccctttcaaagcccagactctcttaatccaggtgatcagcggtcagcaactcccc
aaagtggacaagaccaaagaggggtccattgtggatccactggtgaaagtgcagatcttt
ggtgtccgtctagacacagcacggcaggagaccaactatgtggagaacaatggttttaat
ccatactggggggagacactatgtttccgggtgctggtgcctgaacttgccatgctgcgt
tttgtggtaatggattatgactggaaatcccgaaatgactttattggtcagtacaccctg
ccttggacctgcatgcaacaaggttaccgccacattcacctgctgtccaaagttggcatc
agcctccgcccagcttccatttttgtgtatatctgtatccaggaagacctggagggggat
gagtcctga

DBGET integrated database retrieval system