KEGG   Pongo abelii (Sumatran orangutan): 100171682Help
Entry
100171682         CDS       T01416                                 

Gene name
RXRG, NR2B3
Definition
retinoid X receptor, gamma
Orthology
K08526  
retinoid X receptor gamma
Organism
pon  Pongo abelii (Sumatran orangutan)
Pathway
PPAR signaling pathway
Thyroid hormone signaling pathway
Adipocytokine signaling pathway
Pathways in cancer
Transcriptional misregulation in cancer
Thyroid cancer
Small cell lung cancer
Non-small cell lung cancer
Brite
KEGG Orthology (KO) [BR:pon00001]
 Organismal Systems
  Endocrine system
   04920 Adipocytokine signaling pathway
    100171682 (RXRG)
   03320 PPAR signaling pathway
    100171682 (RXRG)
   04919 Thyroid hormone signaling pathway
    100171682 (RXRG)
 Human Diseases
  Cancers
   05200 Pathways in cancer
    100171682 (RXRG)
   05202 Transcriptional misregulation in cancers
    100171682 (RXRG)
   05216 Thyroid cancer
    100171682 (RXRG)
   05222 Small cell lung cancer
    100171682 (RXRG)
   05223 Non-small cell lung cancer
    100171682 (RXRG)
Transcription factors [BR:pon03000]
 Eukaryotic Type
  Zinc finger
   Cys4 hepatocyte nuclear factor 4-like
    100171682 (RXRG)
Nuclear receptors [BR:pon03310]
 2. Hepatocyte nuclear factor 4 like
  2B. Retinoid X receptor (RXR)
   100171682 (RXRG)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Ensembl: 
UniProt: 
Position
1
AA seq 463 aa AA seqDB search
MYGNYSHFMKFPAGYGGSPGHTGSTSMSPSAALSTGKPMDSHPSYTDTPVSAPRTLSAVG
TPLNALGSPYRVITSAMGPPSGALAAPPGINLVAPPSSQLNVVNSVSSSEDIKPLPGLPG
IGNMNYPSTSPGSLVKHICAICGDRSSGKHYGVYSCEGCKGFFKRTIRKDLIYTCRDNKD
CLIDKRQRNRCQYCRYQKCLVMGMKREAVQEERQRSRERAESEAECASSGHEDMPVERIL
EAELAVEPKTESYGDMNMENSTNDPVTNICHAADKQLFTLVEWAKRIPHFSDLTLEDQVI
LLRAGWNELLIASFSHRSVSVQDGILLATGLHVHRSSAHSAGVGSIFDRVLTELVSKMKD
MQMDKSELGCLRAIVLFNPDAKGLSNPSEVETLREKVYATLEAYTKQKYPEQPGRFAKLL
LRLPALRSIGLKCLEHLFFFKLIGDTPIDTFLMEMLETPLQIT
NT seq 1392 nt NT seq  +upstreamnt  +downstreamnt
atgtatggaaattattctcacttcatgaagtttcccgcaggctatggaggctcccctggc
cacactggctctacatccatgagcccatcagcagccttgtccacagggaagccaatggac
agccaccccagctacacggataccccagtgagtgccccacggactctgagtgcagtgggg
acccccctcaatgccctgggctctccatatcgagtcatcacctctgctatgggcccaccc
tcaggagcactggcagcgcctccaggaatcaacttggttgccccacccagctctcagcta
aatgtggtcaacagtgtcagcagttcagaggacatcaagcccttaccagggcttcccggg
attggaaacatgaactacccatccaccagccctggatctctggttaaacacatctgtgcc
atctgtggagacagatcctcaggaaagcactacggggtatacagttgtgaaggctgcaaa
gggttcttcaagaggacgataaggaaggacctcatctacacgtgtcgggataataaagac
tgcctcattgacaagcgtcagcgcaaccgctgccagtactgtcgctatcagaagtgcctt
gtcatgggcatgaagagggaagctgtgcaagaagaaagacagagaagccgagagcgagcc
gagagtgaggcagaatgtgccagtagtggtcatgaagacatgcctgtggagaggattcta
gaagctgaacttgctgttgaaccaaagacagaatcctatggtgacatgaacatggagaac
tcgacaaatgaccctgttaccaacatatgtcatgctgctgacaagcagcttttcaccctc
gttgaatgggccaagcgtattccccacttctctgacctcaccttggaggaccaggtcatt
ttgcttcgggcagggtggaatgaattgctgattgcctctttctcccaccgctcagtttcc
gtgcaggatggcatccttctggccacgggtttacatgtccacaggagcagtgcccatagt
gctggggtcggctccatctttgacagagttctaactgagctggtttccaaaatgaaagac
atgcagatggacaagtcggagctggggtgcctgcgagccattgtgctctttaacccagat
gccaagggcctgtccaacccctctgaagtggagactctgcgagagaaggtttatgccacc
cttgaggcctacaccaagcagaagtatccagaacagccaggcaggtttgccaagctgctg
ctgcgcctcccagctctgcgctccattggcttgaaatgcctggagcacctcttcttcttc
aagctcatcggggacacccccattgacaccttcctcatggagatgttggagaccccgctg
cagatcacctga

DBGET integrated database retrieval system