KEGG   Pongo abelii (Sumatran orangutan): 100171716Help
Entry
100171716         CDS       T01416                                 

Gene name
USP33
Definition
ubiquitin specific peptidase 33 (EC:3.4.19.12)
Orthology
K11848  
ubiquitin carboxyl-terminal hydrolase 20/33 [EC:3.1.2.15]
Organism
pon  Pongo abelii (Sumatran orangutan)
Class
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1
AA seq 910 aa AA seqDB search
MSAFRNHCPHLDSVGEITKEDLIQKSHGTCQDCKVRGPNLWACLENRCSYVGCGESQVDH
STVHSQETKHYLTVNLTTLRVWCYACSKEVFLDRKLGTQPSLPHVRQPHQIQENSVQDFK
IPSNTTLKTPLVAVFDDLDIEVDEEDELRARGLTGLKNIGNTCYMNAALQALSNCPPLTQ
FFLDCGGLARTDKKPAICKSYLKLMTELWHKSRPGSVVPTNLFQGIKTVNPTFRGYSQQD
AQEFLRCLMDLLHEELKEQVMEVEDPQTITTEETMEEDKSQSDVDFQSCESCSNSDKAEN
ENGSRCFSEDNNETTMLIQDDENNSEMSKDWQKEKMCNKINKVNSEGELDKDRDSISETV
DLNNQETVKVQIHSRASEYITDVHSNDLSTPQILPSNESINPRLSASPPKSGNLWPGLAP
PHKKAQSASPKRKKQHKKYRSVISDIFDGTIISSVQCLTCDRVSVTLETFQDLSLPIPGK
EDLAKLHSSSHPTSIVKAGSCGEAYAPQGWIAFFMEYVKRFVVSCVPSWFWGPVVTLQDC
LAAFFARDELKGDNMYSCEKCKKLRNGVKFCKVQKFPEILCIHLKRFRHELMFSTKISTH
VSFPLEGLDLQPFLAKDSPAQIVTYDLLSVICHHGTASSGHYIAYCRNNLNNLWYEFDDQ
SVTEVSESTVQNAEAYVLFYRKSSEEAQKERRRISNLLNIMEPSLLQFYISRQWLNKFKT
FAEPGPISNNDFLCIHGGVPPRKAGYIEDLVLMLPQNIWDNLYSRYGGGPAVNHLYICHT
CQIEAEKIEKKKKTELEIFIRLNRAFQKEDSPATFYCISMQWFREWESFVKGKDGDPPGP
IDNTKIAVTKCGSVMLRQGADSGQISEETWNFLQSIYGGGPEVILRPPVVHVDPDILQAE
EKIEVETRSL
NT seq 2733 nt NT seq  +upstreamnt  +downstreamnt
atgtcagcttttcgaaatcattgtccacatttggattcagttggtgaaataaccaaagaa
gatttgatacaaaaatctcatggtacttgtcaggattgtaaagtccgaggaccaaatctt
tgggcatgcttggagaatagatgttcatatgttggctgtggtgaatcacaagtagatcac
agcaccgtacattctcaggagacaaagcattatctaactgtgaaccttaccactcttcga
gtatggtgttatgcttgcagcaaagaagtatttttggataggaaattaggaactcagcct
tcattgcctcatgtaagacaacctcaccaaatacaagaaaacagtgtccaggattttaaa
atacccagtaatacaacattaaaaactcctctggttgccgtatttgatgatctggatata
gaagtggatgaagaagatgaacttagggcaagaggtcttacaggtttgaaaaatattgga
aatacttgttacatgaatgcagctttgcaggctctttctaattgcccacctttgacacag
ttttttcttgattgtggaggactagctcgaacagataagaaacctgctatttgtaaaagt
tatctcaaactaatgacagagctgtggcataaaagcaggccaggatctgttgtgcctact
aatctgtttcaaggaattaaaactgtaaatccaacatttcgggggtattctcagcaggat
gctcaagaattccttcgatgtttaatggatctgcttcatgaagaattgaaagagcaagtc
atggaagtagaagatccgcaaaccataaccactgaggagacaatggaagaagacaagagc
cagtcggatgtcgattttcagtcttgtgaatcttgtagcaacagtgataaagcagaaaat
gaaaatggctctagatgcttttctgaagataataatgaaacaacaatgttaattcaggat
gatgaaaacaattcagaaatgtcaaaagattggcaaaaagagaagatgtgcaataagatt
aataaagtaaattctgaaggcgaattagataaagatagagactctatatctgaaacagtc
gacttaaacaaccaggaaactgtcaaagtgcaaatacacagcagagcttcagaatatatc
actgatgtccattcgaatgacctgtctacaccacagatccttccatcaaatgaaagtatt
aatccacgtttatcggcaagccctcctaaatcaggcaatttgtggccaggattggcacca
ccacacaaaaaagctcagtctgcgtctccaaagagaaaaaaacagcacaagaaatacaga
agtgttatttcagacatatttgatggaacaatcattagttcagtgcagtgtctgacttgt
gacagggtgtctgtaaccctcgagacctttcaagatctgtccttgccaattcctggcaag
gaagaccttgctaagctgcattcatcaagtcatccaacttctatagtcaaagcaggatca
tgtggcgaagcatatgctccacaagggtggatagcttttttcatggaatatgtgaagagg
tttgttgtctcatgtgtccctagctggttttggggtccagtagtaaccttgcaagattgt
cttgctgccttctttgccagagatgaactaaaaggtgacaatatgtacagttgtgaaaaa
tgcaaaaagttgagaaatggagtaaagttttgtaaagtacaaaagtttcctgagatttta
tgcatccaccttaaaagattcagacatgaactaatgttttccaccaaaatcagtacccat
gtttcatttccgctggaaggcttggatcttcagccatttcttgctaaggatagtccagct
caaattgtgacatatgatcttctgtcagtcatttgccatcatggaactgcaagtagtgga
cactatatagcctactgccgaaacaatctaaataatctctggtatgaatttgatgatcag
agtgttactgaagtttcagaatctactgtacaaaatgcagaagcttacgttcttttctat
aggaagagcagcgaagaggcacaaaaagagaggagaaggatatcaaatttgttgaacata
atggaaccaagcctccttcagttttatatttctcgacagtggctaaataaatttaagacc
tttgccgaacctggccctatttcaaataatgactttctttgtattcatggaggtgttcct
ccaagaaaagctggttatattgaagacctggttttgatgctgcctcagaacatttgggat
aacctatatagcaggtatggtggaggaccagctgtgaaccatctgtacatttgtcacact
tgccaaattgaggcggagaaaattgaaaaaaaaaaaaaaactgaattggaaatttttatt
cggcttaacagagcgttccaaaaagaggactctccagctactttttattgcatcagtatg
cagtggtttagagaatgggaaagttttgtgaagggtaaagatggagatcctccaggtcct
attgacaatactaagattgcagtcactaaatgtggtagtgtgatgcttaggcaaggagca
gattctggccagatttctgaagaaacatggaattttctgcagtctatttatggtggaggg
cctgaagttatcctacgacctccggttgttcatgttgatccagatatacttcaagcagaa
gaaaaaattgaagtagaaactcggtctttgtaa

DBGET integrated database retrieval system