KEGG   Pongo abelii (Sumatran orangutan): 100171734Help
Entry
100171734         CDS       T01416                                 

Gene name
CYLD
Definition
(RefSeq) ubiquitin carboxyl-terminal hydrolase CYLD
  KO
K08601  ubiquitin thioesterase [EC:3.4.19.12]
Organism
pon  Pongo abelii (Sumatran orangutan)
Pathway
pon04217  Necroptosis
pon04380  Osteoclast differentiation
pon04622  RIG-I-like receptor signaling pathway
pon04625  C-type lectin receptor signaling pathway
Brite
KEGG Orthology (KO) [BR:pon00001]
 Cellular Processes
  Cell growth and death
   04217 Necroptosis
    100171734 (CYLD)
 Organismal Systems
  Immune system
   04622 RIG-I-like receptor signaling pathway
    100171734 (CYLD)
   04625 C-type lectin receptor signaling pathway
    100171734 (CYLD)
  Development
   04380 Osteoclast differentiation
    100171734 (CYLD)
Enzymes [BR:pon01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.19  Omega peptidases
    3.4.19.12  ubiquitinyl hydrolase 1
     100171734 (CYLD)
Peptidases [BR:pon01002]
 Cysteine Peptidases
  Family C67
   100171734 (CYLD)
Ubiquitin system [BR:pon04121]
 Deubiquitinating enzyme (DUB)
  Ubiquitin-specific proteases (UBPs)
   UBP/USP
    100171734 (CYLD)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: CYLD_phos_site CAP_GLY UCH COX_ARM
Motif
Other DBs
NCBI-GeneID: 100171734
NCBI-ProteinID: NP_001124871
Ensembl: ENSPPYG00000007344
UniProt: Q5RED8
Position
16
AA seq 956 aa AA seqDB search
MSSGLWSQDKVTSPYWEERVFYLLLQECSVTDKQTQKLLKVPKGSIGQYIQDRSVGHSRI
PSAKGKKNRIGLKILEQPHAVLFVDEKDVVEINEKFTELLLAITNCEERFSLFKNRNRLS
KGLQIDVGCPVKVQLRSGEEKFPGVVRFRGPLLAERTVSGIFFGVELLEEGRGQGFTDGV
YQGKQLFQCDEDCGVFVALDKLELIEDDDTALESDYAGPGDTMQVELPPLEINSRVSLKV
GETIESGTVIFCDVLPGKESLGYFVGVDMDNPIGNWDGRFDGVQLCSFACVESTILLHIN
DIIPALSESVTQERRPPKLAFMSRGVGDKGSSSHNKPKATGSTSDPGNRNRSELFYTLNG
SSVDSQPQSKSKNTWYIDEVAEDPAKSLTEISTDFDRSSPPLQPPPVNSLSTENRFHSLP
FSLTKMPNTNGSIGHSPLSLSAQSVMEELNTAPVQESPPLAMPPGNSHGLEVGSLAEVKE
NPPFYGVIRWIGQPPGLNEVLAGLELEDECAGCTDGTFRGTRYFTCALKKALFVKLKSCR
PDSRFASLQPVSNQIERCNSLAFGGYLSEVVEENTPPKMEKEGLEIMIGKKKGIQGHYNS
CYLDSTLFCLFAFSSVLDTVLLRPKEKNDVEYYSETQELLRTEIVNPLRIYGYVCATKIM
KLRKILEKVEAASGFTSEEKDPEEFLNILFHHILRVEPLLKIRSAGQKVQDCYFYQIFME
KNEKVGVPTIQQLLEWSFINSNLKFAEAPSCLIIQMPRFGKDFKLFKKIFPSLELNITDL
LEDTPRQCRICGGLAMYECRECYDDPDISAGKIKQFCKTCNTQVHLHPKRLNHKYNPVSL
PKDLPDWDWRHGCIPCQNMELFAVLCIETSHYVAFVKYGKDDSAWLFFDSMADRDGGQNG
FNIPQVTPCPEVGEYLKMSLEDLHSLDSRRIQGCARRLLCDAYMCMYQSPTMSLYK
NT seq 2871 nt NT seq  +upstreamnt  +downstreamnt
atgagttcaggcttatggagccaagacaaagttacttcaccctactgggaagagcgggtt
ttttatttgcttcttcaagaatgcagcgttacagacaaacaaacacaaaagctccttaaa
gtaccgaagggaagtataggacagtatattcaagatcgttctgtggggcattcaaggatt
ccttctgcaaaaggcaagaaaaatcggattggattaaaaattctagagcaacctcatgca
gttctctttgttgatgaaaaggatgttgtagagataaatgaaaagttcacagagttactt
ttggcaatcaccaattgtgaggagaggttcagcctgtttaaaaacagaaacagactaagt
aaaggcctccaaatagacgtgggctgtcctgtgaaagtacagctgagatctggggaagaa
aaatttcctggagttgtacgcttcagaggacccctgttagcagagaggacagtctccgga
atattctttggagttgaattgctggaagaaggtcgtggccaaggtttcactgacggggtg
taccaagggaaacagctttttcagtgtgatgaagattgtggcgtgtttgttgcattggac
aagctagaactcatagaagacgatgacactgcattggaaagtgattatgcaggtcctggg
gacacaatgcaggtcgaacttcctcctttggaaataaactccagagtttctttgaaggtt
ggagaaacaatagaatctggaacagttatattctgtgatgttttgccaggaaaagaaagc
ttaggatattttgttggtgtggacatggataaccctattggcaactgggatggaagattc
gatggagtgcagctttgtagttttgcgtgtgttgaaagtacaattctattgcacatcaat
gatatcatcccagctttatcagagagcgtgacacaggaaaggaggcctcccaaacttgct
tttatgtcaagaggtgttggggacaaaggttcatccagtcataataaaccaaaggctaca
ggatctacctcagaccctggaaatagaaacagatctgaattattttataccttaaatggg
tcttctgttgactcacaaccacaatccaaatcaaaaaatacatggtacattgatgaagtt
gcagaagaccctgcaaaatctcttacagagatatctacagactttgaccgttcttcacca
ccactccagcctcctcctgtgaactcactgtccaccgagaacagattccactctttacca
ttcagtctcacaaagatgcccaataccaatggaagtattggccacagtccactttctctg
tcagcccagtctgtgatggaagagctaaacactgcacccgtccaagagagtccacccttg
gccatgcctcctgggaactcacatggtctagaagtgggctcattggctgaagttaaggag
aaccctcctttctatggggtaatccgttggatcggtcagccaccaggactgaatgaagtg
ctcgctggactggaactggaagatgagtgtgcaggctgtacggatggaaccttcagaggc
actcggtatttcacctgtgccctgaagaaggcgctgtttgtgaaactgaagagctgcagg
cctgactctaggtttgcatcattgcagccggtttccaatcagattgagcgctgtaactct
ttagcatttggaggctacttaagtgaagtagtagaagaaaatactccaccaaaaatggaa
aaagaaggcctggagataatgattgggaagaagaaaggcatccagggtcattacaattct
tgttacttagactcaaccttattctgcttatttgcttttagttctgttctggacactgtg
ttacttagacccaaagaaaagaacgatgtagaatattatagtgaaacccaagagctactg
aggacagaaatcgttaatcctctgagaatatatggatatgtgtgtgccacaaaaattatg
aaactgaggaaaatacttgaaaaggtggaggctgcatcaggatttacctctgaagaaaaa
gatcctgaggaattcttgaatatcctgtttcatcatattttaagggtagaacctttgcta
aaaataagatcagcaggtcaaaaggtacaagattgttacttctatcaaatttttatggaa
aaaaatgagaaggttggagttcccacaattcagcagttgttagaatggtcttttatcaac
agtaacctgaaatttgcagaggcaccatcatgtctgattattcagatgcctcgatttgga
aaagactttaaactatttaaaaaaatttttccttctctggaattaaatataacagattta
cttgaagacactcccagacagtgccggatatgtggagggcttgcaatgtatgagtgtaga
gaatgctacgatgatccggacatctcagctggaaaaatcaagcagttttgtaaaacctgc
aacactcaagtccaccttcatccgaagaggctgaatcataaatataacccagtgtcactt
cccaaagacttacctgactgggactggagacacggctgcatcccttgccaaaatatggag
ttatttgctgttctctgcatagaaacaagccactatgttgcttttgtgaagtatgggaag
gacgattccgcctggctcttctttgacagcatggccgatcgggatggtggtcagaacggc
ttcaacattcctcaagtcaccccatgcccagaagtaggagagtacttgaagatgtctctg
gaagacctgcattccttggactccagaagaatccaaggctgtgcacgaagactgctttgt
gatgcgtatatgtgcatgtaccagagtccaacaatgagtttgtacaaataa

DBGET integrated database retrieval system