KEGG   Pongo abelii (Sumatran orangutan): 100171741Help
Entry
100171741         CDS       T01416                                 

Gene name
KAT6A, MYST3
Definition
K(lysine) acetyltransferase 6A
Orthology
K11305  
histone acetyltransferase MYST3 [EC:2.3.1.48]
Organism
pon  Pongo abelii (Sumatran orangutan)
Pathway
Signaling pathways regulating pluripotency of stem cells
Brite
KEGG Orthology (KO) [BR:pon00001]
 Cellular Processes
  Cellular commiunity
   04550 Signaling pathways regulating pluripotency of stem cells
    100171741 (KAT6A)
Enzymes [BR:pon01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.48  histone acetyltransferase
     100171741 (KAT6A)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
8
AA seq 2010 aa AA seqDB search
MVKLANPLYTEWILEAIKKVKKQKQRPSEERICNAVSSSHGLDRKTVLEQLELSVKDGTI
LKVSNKGLNSYKDPDNPGRIALPKPRNHGKLDNKQNVDWNKLIKRAVEGLAESGGSTLKS
IERFLKGQKDVSALFGGSAASGFHQQLRLAIKRAIGHGRLLKDGPLYRLNTKATNVDGKE
SCESLSCLPPVSLLPHEKDKPVAEPIPICSFCLGTKEQNREKKPEELISCADCGNSGHPS
CLKFSPELTVRVKALRWQCIECKTCSSCRDQGKNADNMLFCDSCDRGFHMECCDPPLTRM
PKGMWICQICRPRKKGRKLLQKKAAQIKRRYANPIGRPKNRLKKQNTVSKGPFSKVRTGP
GRGRKRKITLSSQSASSSSEEGYLERIDGLDFCRDSSVSLKFNKKTKGLIDGLTKFFTPS
PDGRKARGEVVDYSEQYRIRKRGNRKSSTSDWPTDNQDGWDGKQENEERLFGSQEIMTEK
DMELFRDIQEQALQKVGVTGPPDPQVRCPSVIEFGKYEIHTWYSSPYPSRILKGMLPKLY
LCEFCLKYMKSRTILQQHMKKCGWFHPPANEIXQKRINISVFEVDGNVSTIYCQNLCLLA
KLFLDHKTLYYDVEPFLFYVLTQNDVKGCHLVGYFSKEKHCQQKYNVSCIMILPQYQRKG
YGRSSHRFNSYLLSKREGQAGSPEKPLSDLGRLSYMAYWKSVILECLYHQNDKQISIKKL
SKLTGICPQDITSTLHHLRMLDFRSDQFVIIRREKLIQDHMAKLQLNLRPVDVDPECLRW
TPVIVSNSVVSEEEEEEAEEGENEEPQCQERELEISVGKSVSHENKEQDSYSVENEKKPE
VMAPVSSTRLSKQVLPRDSLPANSQPSRRGRWGRKNRKTQERFGDKDSKLLLEETSSAPQ
EQYGECGEKSEATQEQYTESEEQLVASEEQPSQDRKPDLPKRRLSEGVEPWRGQLKKSPE
ALKCRLTEGNERLPRRYSEGDRAVLRGFSESSEEEEEEEPESPRSSSPPILTKPTLKRKK
PFLHRRRRVRKRKHHNSSVVTETISETTEVLDEPFEDSDSERPMPRLEPTFEIDEEEEEE
DENELFPREYFHRLSSQDVLRCQSSSKRKCKDEEEDEESDDADDTPILKPVSLLRKRDMK
NSPLEPDTSTPLKKKKGWPKGKSRKPIHWKKRPGRKPGFKLSREIMPVSTQACIIEPIVS
IPKAGRKPKIQESEETVEAKEDMPLPEERKEEEEMQAEAEEAEEGEEEDAVSSEVPAASP
ADSSNSPETETKEPEVEEEEEKPRVSEEQRQSEEEQQELEEPEPEDEEDAAAETAQNDDH
DADDEDDGHLESTKKKELEEQPTREDVKEEPGVQESFLDANMQKSREKIKDKEETELDSE
EEQPSHDTSVVSEQMPGSEDDHEEDSHTKEELIELKEEEEIPHSELDLETVQAVQSLTQE
ESNEHEGAYQDCEETLAACQTLQSYTQADEDPQMSMVEDCHASEHNSPISSVQSHPSQSV
RSVSSPNVPALESGYTQISPEQGSLSAPSMQNMETSPMMDVPSVSDHSQQVVDSGFSDLG
SIESTTENYENPSSYDSTMGGSICGNSSSQSSCSYGGLSSSSSLTQSSCVVTQQMASMGS
SCSMMQQSSVQPAANCSIKSPQSCVVERPPSNQQQQPPPPPPQQPQPPPPQPQPAPQPPP
PQQQPQQQPQPQPQQPPPPPPPQQQPPLSQCSMNNSFTPAPMIMEIPESGSTGNISIYER
IPGDFGASSYSQPSATFSLAKLQQLTNTIMDPHAMPYSHSPAVTSYATSVSLSNTGLAQL
APSHPLAGTPQAQATMTPPPNLASTTMNLTSPLLQCNMSATNIGIPHTQRLQGQMPVKGH
ISIRSKSAPLPSAAAHQQQLYGRSPSAVAMQAGPRALAVQRGMNMGVNLMPTPTYNVNSM
NMNTLNAMNSYRMTQPMMNSSYHSNPAYMNQTAQYPMQMQMGMMGSQAYTQQPMQPNPHG
NMMYTGPSHHSYMNAAGVPKQSLNGPYMRR
NT seq 6033 nt NT seq  +upstreamnt  +downstreamnt
atggtaaaactcgcaaacccgctttatactgagtggattttggaggccatcaaaaaagtg
aaaaagcagaaacagcgtccttcagaagaaaggatatgcaatgctgtgtcttcatcccat
ggcttggatcgtaaaactgttttagaacaattggagttgagtgttaaagatggaacaatt
ttaaaagtctcaaataaaggactcaattcctataaagatcctgataatcctgggcgaata
gcacttcctaagcctcggaaccatggaaaattggataataaacaaaatgtggattggaat
aaactgataaagcgggcagttgagggcttggcagagtctggtggctcaactttgaaaagc
attgaacgttttttgaaaggtcagaaggatgtgtctgcattattcggaggcagtgctgcc
tctggctttcaccagcagttacgattggctatcaaacgtgccattggccacggcagactc
cttaaagatggacctctttatcggctcaacactaaagcaacgaacgtggatgggaaagag
agttgcgaatctctttcctgtttacctccagtgtcccttcttccacatgaaaaggataag
ccggttgctgaacccatccccatctgtagtttctgtcttggtacaaaagaacaaaaccga
gaaaagaagccagaggaactcatctcctgtgccgactgtggcaacagtggccatccatcc
tgtttaaagttttcccctgaactaacggttcgagtgaaggccttacggtggcagtgcatc
gagtgtaagacatgcagctcctgtcgagatcaaggcaaaaatgcggataacatgctcttt
tgtgattcatgtgaccgaggttttcacatggagtgttgtgatccgccactcacccgtatg
ccaaaaggcatgtggatatgtcaaatatgtcgacctaggaaaaagggacgaaaacttcta
caaaagaaggcagcacagataaaacggcgctatgctaatccaataggacgtccaaaaaac
aggttaaagaaacaaaacacggtatcaaaaggtcccttcagcaaagttcgaactggccct
ggaaggggtaggaaacgaaaaatcactctttccagccaatcagcatcatcatcatcagaa
gaaggatatttagagcggatagatggcttggacttctgcagagatagcagtgtctccttg
aagttcaacaagaaaaccaaagggctcattgatggccttaccaaattttttaccccttcc
cctgatgggcggaaagctcggggggaagtggtggactactccgagcaatatcgaatcaga
aagaggggcaacaggaaatcaagcacttcagattggcccacagacaatcaggatggctgg
gatggcaaacaagaaaatgaggagcggctttttgggagccaggaaatcatgactgagaaa
gatatggaattatttcgtgatatccaagaacaagcactgcagaaagttggagtgactggt
ccccctgatccacaagttcgctgtccctctgtcattgagtttgggaagtacgaaattcac
acctggtactcctccccatatccctcaagaatactcaagggtatgctgcccaaattgtat
ctttgtgaattttgtctaaaatacatgaaaagtagaactattctgcagcagcacatgaag
aaatgtggttggttccatcctcctgccaatgagatttaacagaaaagaattaatatttct
gtctttgaggttgatgggaatgtgagtaccatttattgtcaaaacctgtgtctcttggca
aagttgtttcttgaccacaaaaccctctattacgatgtcgagccatttcttttttatgta
ctaacacagaatgatgtcaagggctgccaccttgttggctacttttctaaggaaaagcac
tgccaacagaagtacaatgtttcctgtataatgattcttcctcaataccagcgtaagggc
tatggcaggtcttctcatcgatttaacagttatttgttatcaaagcgtgaaggccaagca
gggtctccagagaaaccgttatccgatctgggtcgtctttcctacatggcatattggaaa
agtgtaatattggagtgcctttatcaccaaaatgacaagcagatcagcattaagaagtta
agcaagttgactggaatctgccctcaagacatcacttccacactccaccacctacgaatg
ctggacttccgtagtgaccaatttgtgattatccgccgggaaaaacttatccaggatcac
atggcaaagcttcagctgaatttgcgacctgtagatgtagatccagaatgtttgcgctgg
actccagtcatagtgtccaactctgtggtctctgaggaggaagaagaggaggctgaggaa
ggagaaaacgaagagccacagtgccaggaaagagaattagagatcagtgtgggaaagtct
gtgtctcatgagaacaaagaacaagattcttattcagtagaaaatgaaaagaaaccagaa
gttatggctccagtcagttctacacgtttgagcaaacaagtccttcctcgtgatagtctt
cctgcgaatagccagccatctcggaggggccgctgggggaggaagaacagaaaaacccag
gaacgttttggtgataaagattctaaactgctcttggaagagacgtcttcagctcctcag
gaacaatatggagaatgtggggagaaatcagaagccacccaggaacaatacactgaaagt
gaagaacagctggtggcttctgaggagcagccaagccaggacaggaaacctgaccttccc
aagagaagactcagtgagggggttgagccctggcgaggacagctcaagaaaagccctgag
gctctgaagtgcagattaacagaaggaaatgagaggctgccccgccgctacagtgagggt
gacagggctgtcctcaggggcttcagtgagagcagcgaggaggaggaggaggaggagccg
gaaagccctcggtcaagctcgccaccaattctcacaaagcccacgctgaagcgaaagaaa
ccatttctccaccgaaggaggagagtccgaaagcgcaaacaccacaatagcagtgtagtc
acggaaactatttctgagaccactgaagtgttagatgaaccttttgaagattctgactcc
gaaaggccaatgccaagattagaacccacgtttgagatcgatgaagaagaggaggaagag
gatgaaaatgaacttttccctagagaatacttccatcgtttgtcttcgcaggatgtactc
aggtgtcagtcctcttctaagaggaagtgtaaagatgaagaagaagatgaagagtcagat
gatgctgatgacactcctatcctaaagccagtatctcttttgcgaaaacgtgatatgaag
aattctcctcttgagccagatacatccacacctttgaaaaagaaaaagggatggcccaaa
ggcaagagccgcaaaccaatccactggaagaaaagacctggtcgaaaaccaggatttaag
ttgagtcgggaaatcatgccagtttctactcaagcatgcatcattgaacccatcgtttcc
attcctaaagctggacgtaaacccaagatccaggagagtgaagaaactgttgaggcaaaa
gaagacatgcccctacctgaggagaggaaggaggaggaggagatgcaagcagaggcagaa
gaggctgaagagggtgaggaagaggatgcagtcagcagtgaagtcccagcagcctctcca
gcagacagcagcaatagtcctgagaccgaaaccaaggagcccgaggtggaggaggaagaa
gagaagccccgtgtctcagaggagcagaggcagtcagaggaggagcagcaggaattagag
gagccagagccagaggatgaggaagatgcagctgccgagactgcccagaatgatgaccat
gacgctgatgatgaggatgatggccacctggagtccacaaagaaaaaggagctagaggaa
cagcccacaagggaagatgtcaaggaggagcctggtgttcaagagtcttttttagatgct
aatatgcagaagagtagggaaaagataaaggataaagaggaaaccgagctggattccgaa
gaggaacagccttcccatgacacgtccgtggtgtcagagcagatgcctgggtctgaggac
gaccacgaagaagactcccacactaaggaagagttaattgaattaaaagaggaggaagag
attcctcatagtgaactggatctggaaactgtacaggcagtgcagtctttgactcaagaa
gaaagcaatgagcatgagggtgcctaccaggactgtgaggaaactctcgcggcgtgtcag
actctgcagagttacacccaggctgacgaggaccctcagatgtccatggttgaagactgt
catgcgtcagaacataatagccctatctcctctgttcagtctcaccccagccagtcagtc
cgttcggtcagcagtcccaacgtgcctgcccttgagagtggctacacccagatcagccca
gaacaaggatccctgtccgcaccctctatgcagaacatggagaccagccccatgatggat
gtgccttccgtatcagaccactctcagcaggtggtggacagcggcttcagtgacctgggc
agcattgagagcaccactgaaaactatgagaacccgagcagttacgactccacgatgggc
ggcagcatctgtgggaacagctcttcccagagcagctgctcctacggtggactgtcgtcc
tctagcagcctcacccagagcagctgtgtggtcactcagcagatggccagcatgggcagc
agctgcagcatgatgcagcagagcagcgtccagcctgctgccaactgcagcatcaagtca
cctcagagctgcgtggtggagaggcctcccagtaaccagcagcagcagccgccaccaccg
cctccacagcagccgcagccgccgccgccacaaccacaaccagcaccacagcctccacca
ccccagcagcagccgcagcagcagccacagcctcagccccagcagcctccacccccaccc
cctccccagcagcagcccccgctgtcacagtgtagtatgaataacagtttcaccccagct
cctatgatcatggagataccagaatctggaagcactgggaacataagtatctatgagagg
attccaggggattttggtgccagcagctactctcaaccatcagccaccttcagcctagcc
aagctgcagcagctgaccaacaccattatggaccctcatgccatgccttatagccattct
cctgctgtgacttcctatgcaaccagtgtttctctgtccaatacaggactggctcagctg
gctccatctcatcccttagctgggactcctcaagcacaagccaccatgacgccaccccca
aacttggcatccactaccatgaacctcacgtctcctctgcttcagtgcaacatgtctgcc
accaacattggcattcctcacacgcagagattgcaagggcaaatgccagtgaaggggcac
atttccatccgctccaagtctgcgccactgccctctgcggctgctcaccagcagcagctg
tatggccgtagcccatcggcagttgccatgcaggctggccctcgtgcactagctgttcag
cgtggcatgaacatgggggttaatctgatgcctactcccacctataatgtcaattccatg
aatatgaacaccttgaatgccatgaacagctatcgaatgacacagcccatgatgaacagc
agttaccatagtaaccctgcctacatgaaccagacagcacagtatcctatgcagatgcag
atgggaatgatggggagccaggcctatacccagcagcctatgcagcctaaccctcatggg
aacatgatgtacacaggcccctcccatcacagctacatgaacgctgctggcgtgcccaag
cagtcactcaacggaccttacatgagaagatga

DBGET integrated database retrieval system