KEGG   Pongo abelii (Sumatran orangutan): 100171744Help
Entry
100171744         CDS       T01416                                 

Gene name
PCSK2, NEC2
Definition
proprotein convertase subtilisin/kexin type 2 (EC:3.4.21.94)
Orthology
K01360  
proprotein convertase subtilisin/kexin type 2 [EC:3.4.21.94]
Organism
pon  Pongo abelii (Sumatran orangutan)
Brite
Enzymes [BR:pon01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.21  Serine endopeptidases
    3.4.21.94  proprotein convertase 2
     100171744 (PCSK2)
Peptidases [BR:pon01002]
 Serine Peptidases
  Family S8: subtilisin family
   100171744 (PCSK2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Ensembl: 
UniProt: 
Position
20
AA seq 638 aa AA seqDB search
MKGGCVSQWKAAAGFLFCVMVFASAERPVFTNHFLVELHKGGEDEARQVAAEHGFGVRKL
PFAEGLYHFYHNGLAKAKRRRSLHHKQQLERDPRVKMALQQEGFDRKKRGYRDINEIDIN
MNDPLFTKQWYLINTGQADGTPGLDLNVAEAWELGYTGKGVTIGIMDDGIDYLHPDLASN
YNAEASYDFSSNDPYPYPRYTDDWFNSHGTRCAGEVSAAANNNICGVGVAYNSKVAGIRM
LDQPFMTDIIEASSISHMPQLIDIYSASWGPTDNGKTVDGPRELTLQAMADGVNKGRGGK
GSIYVWASGDGGSYDDCNCDGYASSMWTISINSAINDGRTALYDESCSSTLASTFSNGRK
RNPEAGVATTDLYGNCTLRHSGTSAAAPEAAGVFALALEANLGLTWRDMQHLTVLTSKRN
QLHDEVHQWRRNGVGLEFNHLFGYGVLDAGAMVKMAKDWKTVPERFHCVGGSVQDPEKIP
STGKLVLTLTTDACEGKENFVRYLEHVQAVITVNATRRGDLNINMTSPMGTKSILLSRRP
RDDDSKVGFDKWPFMTTHTWGEDARGTWTLELGFVGSAPQKGVLKEWTLMLHGTQSAPYI
DQVVRDYQSKLAMSKKEELEEELDEAVERSLKSILNKN
NT seq 1917 nt NT seq  +upstreamnt  +downstreamnt
atgaagggtggttgtgtctcccagtggaaggcggccgccgggttcctcttctgtgtcatg
gtttttgcatctgctgagcgaccggtcttcacgaatcattttcttgtggagttgcataaa
gggggagaggacgaagctcgccaagttgcagcagaacacggctttggagtccgaaagctt
ccctttgctgaaggtctgtaccacttttatcacaatggccttgcaaaggccaagagaaga
cgcagcctacaccacaagcagcagctggagagagaccccagggtaaagatggctttgcag
caggaaggatttgaccgaaaaaagcgaggttacagagacatcaatgagatcgacatcaac
atgaacgatcctctttttacaaagcaatggtatctgatcaatactgggcaagctgatggc
actcctggccttgatttgaatgtggctgaagcctgggagctgggatacacagggaaaggt
gttaccattgggattatggatgacgggattgactatctccacccggacctggcctccaac
tataatgccgaagcaagttacgacttcagcagcaacgacccctatccttaccctcggtac
acagatgactggtttaacagccacgggacccgatgtgcaggagaagtttctgctgctgcc
aacaacaatatctgtggagttggagtagcatacaactccaaggttgcaggcatcaggatg
ctggaccagccatttatgacggacatcatcgaggcctcctccatcagccatatgccgcag
ctgatcgacatctacagcgccagctggggccccacagacaacggcaagacagtggatggg
ccccgggagctcacgctgcaggccatggccgatggcgtgaacaagggccgcggcggcaaa
ggcagcatctacgtgtgggcctctggggacggcggcagctatgacgactgcaactgcgac
ggctacgcctccagcatgtggaccatctccatcaactcagccatcaacgatggcaggacc
gccctgtatgacgagagctgctcttccaccttggcttccaccttcagcaacgggaggaaa
aggaaccctgaggccggtgtggcaaccacagatctgtacggcaactgcactctgaggcat
tctgggacatctgcagctgcccccgaggcagctggcgtgtttgcactggctctggaggct
aacctgggtctgacctggcgggacatgcagcatctgactgtgctcacctccaaacggaac
cagcttcacgacgaggtccatcagtggcggcgcaatggggtcggcctggaatttaatcac
ctctttggctatggggtccttgatgcaggcgccatggtgaaaatggctaaagactggaaa
accgtgcctgagagattccactgtgtgggaggctccgtgcaggaccctgagaaaatacca
tccactggcaagttggtgctgacactcacaaccgacgcctgtgaggggaaggaaaatttt
gtccgctacctggagcatgtccaggctgtcatcacggtcaacgcaaccaggagaggagac
ctgaacatcaacatgacgtcccctatgggcaccaagtccattttgctgagccggcgtcca
agggatgatgactccaaggtgggctttgacaagtggcctttcatgaccactcacacgtgg
ggggaagacgcccgaggcacctggaccctggagctgggatttgtcggcagcgccccgcag
aagggggtgctgaaggagtggaccctgatgctgcatggcactcagagcgccccatacatc
gaccaggtggtgcgggattaccagtccaagctggccatgtccaagaaagaggagctggag
gaagagctggacgaagctgtggagagaagcctgaaaagcatccttaacaagaactag

DBGET integrated database retrieval system