KEGG   Pongo abelii (Sumatran orangutan): 100171781Help
Entry
100171781         CDS       T01416                                 

Gene name
USP18
Definition
ubiquitin specific peptidase 18 (EC:3.1.2.-)
Orthology
K11846  
ubiquitin carboxyl-terminal hydrolase 18/41 [EC:3.1.2.15]
Organism
pon  Pongo abelii (Sumatran orangutan)
Class
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
Un
AA seq 375 aa AA seqDB search
MSKAFGLLRQTCQSILAESPQSPADLEEKKEEDSNMKREQPRERPRAWDYPHGLVGLHNI
GQTCCLNSLIQVFVMNVDFARILKRITVPRGADEQRRSVPFQMLLLLEKMQDSRQKAVRP
LELAYCLQKYNVPLFVQHDAAQLYLKLWNLMKDQITDVHLVERLQALYMIRMKDSLICLD
CAMESSRNSSMLTLPLSLFDVDSKPLKTLVGQEDALHCFFQPRELSRKSKCFCENCGKKT
HRKQVLKLTHFPQTLTIHLMRFSIRNSQTRKICHSLYFPQSLDFSQVLPTKQKSCDAEEQ
PGGQFELFAVIAHVGMADSGHYCVYIRNAVDGKWFCFNDSNICLVSWEDIQCTYGNPNYH
WQETAYLLVYMKMEC
NT seq 1128 nt NT seq  +upstreamnt  +downstreamnt
atgagcaaggcgtttgggctcctgagacaaacctgtcagtccatcctggctgagtctccg
cagtccccggcagatcttgaagaaaagaaggaagaagacagcaacatgaagagagagcag
cccagagagcgtcccagggcctgggactaccctcatggcctggttggtttacacaacatt
ggacagacctgctgccttaactccttgattcaggtatttgtaatgaatgtggacttcgcc
aggatattgaagaggatcacggtgcccaggggagctgatgagcagaggagaagcgtccct
ttccagatgcttctgctgctggagaagatgcaggacagccggcagaaagcagtgcggccc
ctggagctggcctactgcctgcagaagtacaatgtgcccctgtttgtccaacatgatgct
gctcaactgtacctcaaactctggaacctgatgaaggaccagatcactgatgtgcacttg
gtggagaggctgcaggccctgtatatgatccggatgaaggactccttgatttgccttgac
tgtgccatggagagtagcagaaacagcagcatgctcaccctcccactttctctttttgat
gtggactcaaagcccctgaagacactggtgggacaggaggacgccctgcattgcttcttc
cagcccagggagttatcaagaaaaagcaagtgcttctgtgagaactgtgggaagaagacc
cataggaaacaggtcttgaagctgacccattttccccagaccctgacaatccacctcatg
cgattctccatcaggaattcacagacgagaaagatctgccactccctgtacttcccccag
agcttggatttcagtcaggtccttccaacgaagcaaaagtcttgtgatgctgaagagcag
cctggagggcagtttgagctttttgctgtgattgcgcacgtgggaatggcagactccggt
cattactgtgtctacatccggaatgctgtggatggaaaatggttctgcttcaatgactcc
aatatttgcttggtgtcctgggaagacatccagtgtacctatggaaatcctaactaccac
tggcaggaaactgcatatcttctggtttacatgaagatggagtgctaa

DBGET integrated database retrieval system