KEGG   Pongo abelii (Sumatran orangutan): 100171913Help
Entry
100171913         CDS       T01416                                 

Gene name
ITGB6
Definition
integrin, beta 6
Orthology
K06589  
integrin beta 6
Organism
pon  Pongo abelii (Sumatran orangutan)
Pathway
PI3K-Akt signaling pathway
Focal adhesion
ECM-receptor interaction
Regulation of actin cytoskeleton
Hypertrophic cardiomyopathy (HCM)
Arrhythmogenic right ventricular cardiomyopathy (ARVC)
Dilated cardiomyopathy
Brite
KEGG Orthology (KO) [BR:pon00001]
 Environmental Information Processing
  Signal transduction
   04151 PI3K-Akt signaling pathway
    100171913 (ITGB6)
  Signaling molecules and interaction
   04512 ECM-receptor interaction
    100171913 (ITGB6)
 Cellular Processes
  Cell motility
   04810 Regulation of actin cytoskeleton
    100171913 (ITGB6)
  Cellular commiunity
   04510 Focal adhesion
    100171913 (ITGB6)
 Human Diseases
  Cardiovascular diseases
   05410 Hypertrophic cardiomyopathy (HCM)
    100171913 (ITGB6)
   05412 Arrhythmogenic right ventricular cardiomyopathy (ARVC)
    100171913 (ITGB6)
   05414 Dilated cardiomyopathy (DCM)
    100171913 (ITGB6)
Exosome [BR:pon04147]
 Exosomal proteins
  Exosomal proteins of epithelial cells
   100171913 (ITGB6)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Ensembl: 
UniProt: 
Position
2B
AA seq 715 aa AA seqDB search
MITYKVAVPWEVQKPVKTACLLDLSVPGVLRRILPVHLELAKGGAQTLQVHVRQTEDYPV
DLYYLMDLSASMDDDLNTIKELGSRLSKEMSKLTSNFRLGFGSFVEKPVSPFVKTTPEEI
ANPCSSIPYFCLPTFGFKHILPLTNDAERFNEIVKNQKISANIDTPEGGFDAIMQAAVCK
EKIGWRNDSLHLLVFVSDADSHFGMDSKLAGIVIPNDGLCHLDSKNEYSMSTVLEYPTIG
QLIDKLVQNNVLLIFAVTQEQVHLYENYAKLIPGATVGLLQKDSGNILQLIISAYEELRS
EVELEVLGDTEGLNLSFTAICNNGTLFQHQKKCSHMKVGDTASFNVTVNIPNCERRSRHI
IIKPVGLGDALELLVSPECNCDCQKEVEVNSSKCHHGNGSFQCGVCACHPGHMGPRCECG
EDILSTDSCKEAPDHPSCSGRGDCYCGQCICHLSPYGNIYGPYCQCDNFSCMRHKGLLCG
GNGDCDCGECVCRSGWTGEYCNCTTSTDSCISEDGVLCSGRGDCVCGKCVCTNPGASGPT
CERCPTCGDPCNSKRSCIECHLSAAGQAQEECVDKCKLAGATISEEEDFSKDGSVSCSLQ
GENECLITFLITTDNEGKTIIHSINEKDCPKPPNIPMIMLGVSLAILLIGVVLLCIWKLL
VSFHDRKEVAKFEAERSKVKWQTGTNPLYRGSTSTFKNVTYKHREKQKVDLSTDC
NT seq 2148 nt NT seq  +upstreamnt  +downstreamnt
atgatcacgtacaaggtggctgtgccctgggaggtgcagaaacctgtgaagactgcctgc
ttattggacctcagtgtgcctggtgtgctcaggagaattttacccgtccatctggagttg
gcgaaaggtggtgcgcagactctgcaggtgcatgtccgccagactgaggactacccggtg
gatttgtattacctcatggacctctctgcctccatggatgatgacctcaacacaatcaag
gagctgggctcccggctttccaaagagatgtctaaattaaccagcaactttagactgggc
tttggatcttttgtagaaaaacctgtatccccttttgtgaaaacaacaccggaagaaatt
gccaacccttgcagtagtattccatacttctgtttacctacatttggattcaagcatatt
ttgccattgacaaatgatgctgaaagattcaatgaaattgtgaagaatcagaaaatttct
gctaatattgacacacccgaaggtggatttgatgcaattatgcaagctgctgtgtgtaag
gaaaaaattggctggcggaatgactccctccacctcctggtctttgtgagtgatgctgat
tctcattttggaatggacagcaaactagcaggcatcgtcattcctaatgacgggctctgt
cacttggacagcaagaatgaatactccatgtcaactgtcttggaatatccaacaattgga
caactcattgataaactggtacaaaacaatgtgttattgatcttcgctgtaacccaagaa
caagttcatttatatgagaattacgcaaaacttattcctggagctacagtagggctactt
cagaaggactccggaaacattctccagctgatcatctcagcttatgaagaactgcggtct
gaggtggaactggaagtattaggagacactgaaggactcaacttgtcatttacagccatc
tgtaacaacggtaccctcttccaacaccaaaagaaatgctctcacatgaaagtgggagac
acagcttccttcaacgtgactgtgaatatcccaaactgcgagagaagaagcaggcacatt
atcataaagcctgtggggctgggggacgccctggaattacttgtcagtccagaatgcaac
tgcgactgtcagaaagaagtggaagtgaacagctccaaatgtcaccatgggaacggctcc
ttccagtgtggggtgtgtgcctgccaccctggccacatggggcctcgctgtgagtgtggc
gaggacatactgagcacagattcctgcaaggaggccccagatcatccctcctgcagcgga
aggggtgactgctactgtgggcagtgtatctgccacttgtctccctatggaaacatttat
gggccttattgccagtgtgacaatttctcctgcatgagacacaaagggctgctctgcgga
ggtaacggcgactgtgactgtggtgaatgtgtgtgcaggagtggctggactggcgagtac
tgcaactgcaccaccagcacggactcctgcatctctgaagacggagtgctctgcagtggg
cgcggggactgtgtttgtggcaagtgtgtttgcacaaaccctggagcctcaggaccaacc
tgtgaacgatgtcctacctgtggtgacccctgtaactctaaacggagctgcattgaatgc
cacctgtcagcagctggccaagcccaagaagaatgtgtggacaagtgcaaactagctggt
gcgaccatcagtgaagaagaagatttctcaaaggatggttctgtttcctgctctctgcaa
ggagaaaatgaatgtcttattacattcctaataactacagataatgaggggaaaaccatc
attcacagtatcaatgaaaaagattgtccgaagcctccaaacattcccatgatcatgtta
ggggtttccctggctattcttctcatcggggttgtcctactgtgcatctggaagctactg
gtgtcatttcatgatcgtaaagaagttgccaaatttgaagcagaacgatcaaaagtcaag
tggcaaacgggaaccaatccactctacagaggctccacaagtacttttaaaaatgtaact
tataaacacagggaaaaacaaaaggtagacctttccacagattgctag

DBGET integrated database retrieval system