KEGG   Pongo abelii (Sumatran orangutan): 100172005Help
Entry
100172005         CDS       T01416                                 

Gene name
RASGRF2
Definition
Ras protein-specific guanine nucleotide-releasing factor 2
Orthology
K12326  
Ras-specific guanine nucleotide-releasing factor 2
Organism
pon  Pongo abelii (Sumatran orangutan)
Pathway
MAPK signaling pathway
Ras signaling pathway
Brite
KEGG Orthology (KO) [BR:pon00001]
 Environmental Information Processing
  Signal transduction
   04014 Ras signaling pathway
    100172005 (RASGRF2)
   04010 MAPK signaling pathway
    100172005 (RASGRF2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Ensembl: 
Position
5
AA seq 1147 aa AA seqDB search
MQKSVRYNEGHALYLAFLARKEGTKRGFLSKKTAEASRWHEKWFALYQNVLFYFEGEQSC
RPAGMYLLEGCSCERTPAPPRAGAGPGGVRDALDKQYYFTVLFGHEGQKPLELRCEEEQD
GKEWMEAIHQASYADVLIEREVLMQKYIHLVQIVETEKIAANQLRHQLEDQDTEIERLKS
EIIALNKTKERMRPYQSNQEDEDPDIKKIKKLHEIFHQGLKARIANWPTLILADLFDILL
PMLNIYQEFVRNHQYSLQVLANCKQNRDFDKLLKQYEANPACEGRMLETFLTYPMFQIPR
YIITLHELLAHTPHEHVERKSLEFAKSKLEELSRVMHDEVSDTENIRKNLAIERMIVEGC
DILLDTSQTFIRQGSLIQVPSVERGKLSKVRLGSLSLKKEGERQCFLFTKHFLICTRSSG
GKLHLLKTGGVLSLIDCTLIEEPDASDDDSKGSGQVFGHLDFKIVVEPPDAAAFTVVLLA
PSRQEKAAWMNDISQCVDNIRCNGLMTIVFEENSKVTVPHMIKSDARLHKDDTDICFSKT
LNSCKVPQIRYASVERLLERLTDLRFLSIDFLNTFLHTYRIFTTAAVVLGKLSDIYKRPF
TSIPVRSLELFFATSQNNRGEHLVDGKSPRLCRKFSSPPPLAVSRTSSPVRARKLSLTSP
LNSKIGALDLTTSSSPTTTTQSPAASPPPHTGQIPLDLSRGLSSPEQSPGSVEENVDNPR
VDLCNKLKRSIQKAVLESAPVDRAGVESSPAADTTELSPCRSPSTPRHLRYRQPGGQTAD
NAHCSVSPASAFAIATAAAGHGSPPGFNNTERTCDKEFIIRRTATNRVLNVLRHWVSKHA
QDFELNNELKMNVLNLLEEVLRDPDLLPQERKATANILRALSQDDQDDIHLKLEDIIQMT
DCMKAECFESLSAMELAEQITLLDHVIFRSIPYEEFLGQGWMKLDKNERTPYIMKTSQHF
NDMSNLVASQIMNYADVSSRANAIEKWVAVADICRCLHNYNGVLEITSALNRSAIYRLKK
TWAKVSKQTKALMDKLQKTVSSEGRFKNLRETLKNCNPPAVPYLGMYLTDLAFIEEGTPN
FTEEGLVNFSKMRMVSHIIREIRQFQQTSYRIDHQPKVTQYLLDKDLIIDEDTLYELSLK
IEPRLPA
NT seq 3444 nt NT seq  +upstreamnt  +downstreamnt
atgcagaagagcgtgcgctacaacgaggggcacgccctgtacctggcctttctggcgcgc
aaggagggcaccaagcgcggcttcctgagtaagaagacggccgaggcgagccgctggcac
gagaagtggttcgccctctaccagaatgtgctcttctacttcgagggcgagcagagctgc
cgcccggcgggcatgtacctcctggagggctgcagctgcgaacgaacgcccgcgccaccc
agggccggcgccgggccgggaggcgtccgagacgcgctggacaagcagtattactttact
gttctttttggccacgaaggtcagaagccactggagctgcgctgtgaggaggagcaggat
ggtaaagagtggatggaggccattcaccaagccagttatgcagacgttttgattgagagg
gaagtattaatgcagaagtacattcatctagttcagatcgtagagacagaaaaaattgca
gctaaccaactccgacatcaactggaagatcaagacacagaaatcgaaaggcttaaatca
gagattattgctcttaataaaaccaaagaacgaatgcgaccttaccaaagcaaccaagaa
gatgaagatccagatatcaagaagattaaaaagcttcatgaaatatttcatcaaggacta
aaggcaaggatagcaaactggcccactttaattttagctgatctgtttgatattttgctc
cccatgctgaacatttatcaagaatttgtgcgtaatcaccagtacagcctgcaagttctc
gccaattgtaagcaaaacagagattttgacaaactcttaaaacagtatgaagccaatcca
gcctgtgaggggaggatgctggagacattcttgacctatcccatgtttcagatccccaga
tatatcatcacactccatgagctcctcgctcacacaccccatgagcatgtggaaaggaaa
agcctggagtttgccaaatcaaagctagaggaactgtccagagtaatgcacgatgaagtc
agcgacactgaaaacataaggaaaaaccttgccatcgaaagaatgatcgtggagggctgt
gacatcttgctggacaccagccaaacgttcatccgccaaggttctcttattcaagtacct
tctgttgagagggggaaacttagtaaagttcgcctgggttccttgtctttgaaaaaggaa
ggagagagacaatgcttcttatttacaaaacactttttaatatgtacaagaagttcagga
gggaagcttcatctgctcaagacaggtggggttctgtctctaatagactgcacattgatt
gaggagccagatgcaagcgatgatgactctaaaggttctgggcaagtgtttgggcacctg
gattttaaaatagtggtggaacctcccgacgctgccgccttcactgttgtcttgttagca
ccctcacgccaggagaaagctgcctggatgaatgacatcagtcagtgtgtggacaatata
cgatgtaatggtttaatgactatagtgtttgaagagaattccaaagtcactgtgccacat
atgattaagtctgatgcccgtcttcataaagacgacactgacatttgcttcagtaaaaca
ctcaactcctgcaaagtgccccagatccgttacgccagcgtggagcgcctcttggaacga
ctgacagacttgcggtttcttagtattgatttcctcaacacctttctgcacacctatcgt
attttcactactgctgctgtggtgctggggaaactctccgacatatacaagaggcctttc
acctccatccccgtcaggtcattggaattgttttttgctaccagccagaacaacagaggt
gaacatttggtggatggcaaatccccacgtctgtgtcgcaaattctcttccccgccacca
ctggctgtgtccagaacatcttccccagtgagggccagaaagctgtctttgacttctccc
ttgaactcaaagataggagcattggacctgacaacttccagcagtcccaccaccaccacc
cagagccccgctgcatctccaccaccacacaccggtcaaataccactggatctcagcaga
ggcctctcttctccagagcaaagcccgggatcggtagaagagaatgtcgataacccacgt
gtggatctgtgtaacaagctaaaacgaagtattcaaaaagcagtcctagagtctgcacca
gtggaccgagcaggagtggaaagctcccctgcagcggacactacagaactttcaccttgc
agatccccctcaactccccggcacctccgctatcgccagcctggaggacagacggcggac
aatgcccactgctctgtttcaccggcttctgcttttgcaatagccacagctgcagcagga
catgggagtccaccaggctttaacaacaccgagagaacatgtgataaagagtttattata
cggagaacggctaccaatcgagttctgaacgtcctccgtcactgggtctcaaagcacgcc
caggatttcgaactcaacaatgaactaaagatgaatgtcctaaatttgctagaagaagtt
ttgcgagacccagaccttcttccccaagaaaggaaagccaccgcaaatatcctcagggcc
ctttcacaagatgaccaagatgacatccacctaaaattagaggatataattcaaatgact
gactgcatgaaggccgaatgctttgagtccttgtcggccatggagctggcagaacagatc
accctcctggaccacgtcattttcagaagcattccctacgaggagtttcttgggcagggg
tggatgaagctggataaaaacgaaagaactccttacattatgaaaaccagccaacacttt
aatgacatgagtaacctggtggcctcccagattatgaactatgctgatgtcagctcccgt
gccaacgccatcgagaaatgggtggcggtggcggacatctgccgatgcctgcacaactac
aacggcgtgctggagatcacctcggccttaaacagaagtgccatctacaggctgaagaaa
acctgggccaaggtctctaagcagacaaaagctctaatggacaaacttcaaaagactgtt
tcctctgaaggaagatttaaaaatcttagagaaacccttaaaaattgtaaccctcctgca
gttccttatcttgggatgtacttgacagacctggcatttattgaagaaggaacaccaaac
tttactgaggaaggccttgtcaatttctccaaaatgagaatggtatcacacatcatcaga
gagatacgccagttccagcagacttcctacagaatagatcatcagccaaaggtcacacag
tacttgcttgacaaagaccttatcatagatgaagatacgctatatgagctgtcactaaaa
attgaacctcgactccctgcttga

DBGET integrated database retrieval system