KEGG   Pongo abelii (Sumatran orangutan): 100172090Help
Entry
100172090         CDS       T01416                                 

Gene name
DHCR7
Definition
7-dehydrocholesterol reductase (EC:1.3.1.21)
Orthology
K00213  
7-dehydrocholesterol reductase [EC:1.3.1.21]
Organism
pon  Pongo abelii (Sumatran orangutan)
Pathway
Steroid biosynthesis
Metabolic pathways
Module
Cholesterol biosynthesis, squalene 2,3-epoxide => cholesterol
Brite
KEGG Orthology (KO) [BR:pon00001]
 Metabolism
  Lipid metabolism
   00100 Steroid biosynthesis
    100172090 (DHCR7)
Enzymes [BR:pon01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.1  With NAD+ or NADP+ as acceptor
    1.3.1.21  7-dehydrocholesterol reductase
     100172090 (DHCR7)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
11
AA seq 475 aa AA seqDB search
MAAKSQPNIPKAKSLDGVTNDRTASQGQWGRAWEVDWFSLASVIFLLLFAPFIVYYFIMA
CDQYGCALTSPMVDIITGRARLSDIWAKTPPITRKAAQLYTLWVTFQVLLYTSLPDFCHK
FLPGYAGGIQEGAVTPAGVVNKYQINGLQAWLLTHLLWFANAHLLSWFSPTIIFDNWIPL
LWCANILGYAVSTFAMVKGYFFPTSARDCKFTGNFFYNYMMGVEFNPRIGKWFDFKLFFN
GRPGIVAWTLINLSFAAKQRELHGHVTNAMVLVNVLQAIYVIDFFWNETWYLKTIDICHD
HFGWYLGWGDCVWLPYLYTLQGLYLVYHPVQLSTPHAVGVLLLGLVGYYIFRVANHQKDL
FRRTDGRCLIWGRKPKVIECSYTSADGQRHHSKLLVSGFWGVARHFNYVGDLMGSLAYCL
ACGGSHLLPYFYIIYMAILLTHRCLRDEHRCASKYGRDWERYTAAVPYRLLPGIF
NT seq 1428 nt NT seq  +upstreamnt  +downstreamnt
atggctgcaaaatcgcaacccaacattcccaaagccaagagtctggatggcgtcaccaat
gacagaaccgcatctcaagggcagtggggccgtgcctgggaggtggactggttttcactg
gcgagcgtcatcttcctactgctgttcgcccccttcattgtctactacttcatcatggcg
tgtgaccagtatggctgcgccctgaccagccccatggtggacatcatcaccggacgtgct
cggctctcggacatctgggccaagactccacctataacgaggaaagccgcccagctctat
accttgtgggtcaccttccaggtgcttctgtacacgtctctccctgacttctgccataag
tttctacccggctacgcaggaggcatccaggagggggccgtgactcctgcaggggttgtg
aacaagtatcagatcaacggcctgcaagcctggctccttacgcacctgctctggtttgca
aatgctcatctcctgtcctggttctcacccaccatcatcttcgacaactggatcccactg
ctgtggtgtgccaacatcctcggctatgccgtctccaccttcgccatggtcaagggctac
ttcttccccaccagcgccagagactgcaaattcacaggcaatttcttttacaactacatg
atgggcgtcgagtttaaccctcggattgggaagtggtttgacttcaagctgttcttcaat
gggcgccccgggatcgtcgcctggactctcatcaacctgtccttcgcagcgaagcagcgg
gagctccacggccacgtgaccaatgccatggtcctggtcaacgtcctgcaggccatctac
gtgattgacttcttctggaacgaaacctggtacctgaagaccattgacatctgccatgac
cacttcgggtggtacctgggctggggcgactgtgtctggctgccttacctttacacgcta
cagggtctgtacttggtgtaccaccccgtgcagctgtccaccccacatgccgtgggtgtc
ctgctgctgggcctggtgggctactacatcttccgggtggccaaccaccagaaggacctg
ttccgccgcacagatgggcgctgcctcatctggggcaggaagcccaaggtcatcgagtgc
tcctacacatccgctgatgggcagaggcaccacagcaagctgctggtgtcgggcttctgg
ggcgtggcccgccacttcaactacgtcggcgacctgatgggcagcctggcctactgcctg
gcctgcggtggcagccacctgctgccctacttctacatcatctacatggccatcctactg
acccaccgctgcctccgggatgagcaccgctgcgccagcaagtacggccgggactgggag
cgctacactgccgcggtgccttaccgcctgctgcctggaatcttctaa

DBGET integrated database retrieval system