KEGG   Pongo abelii (Sumatran orangutan): 100172153Help
Entry
100172153         CDS       T01416                                 

Gene name
CES3
Definition
carboxylesterase 3 (EC:3.1.1.1)
Orthology
K15743  
carboxylesterase 3/5 [EC:3.1.1.1]
Organism
pon  Pongo abelii (Sumatran orangutan)
Class
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
16
AA seq 569 aa AA seqDB search
MRLHRLRARLNAVAFGLLLLLVHGQGPEIVQPEVDTTLGRVRGRQVGVKGTDRLVNVFLG
IPFAQPPLGPDRFSAPHPAQPWEGVRDASAAPPMCLQDVESMNNSRFVLNGKQQIFSVSE
DCLVLNIYSPAEATAGAGRPVMVWVHGGALITGAATSYDGSALAAYGDVVVVTVQYRLGV
LGFFSTGDEHAPGNQGFLDVVAALRWVQGNITPFGGDLNCVTVFGGSAGGSIVSGLVLSP
MAAGLFHRAITQSGVITTPGIIESHPWPLAQKITNTLACSSSSPAEMVQCLRQKEGEELV
LSKKLKSTIYPLTVDGTVFPKSPKELLKEKPFHSVPFLMGVNNHEFSWLIPRGWGLLDTM
EQMSREDMLAISTPVLTSLDVPPEMMPTVIDEYLGSNSDAQAKCLAFQEFMGDVFINVPT
VSFSRYLRDSGSPVFFYEFQHRPSSFAKIKPAWVKADHAAEGAFVFGGPFLMDESSRLAF
PEATEEEKQLSLTMMAQWTHFARTGDPNSKGLPPRPRFNQAEQYLEINPVPRAGQKFRET
RMQFWSETLPSKIQQWHQKQKNRKAQEDL
NT seq 1710 nt NT seq  +upstreamnt  +downstreamnt
atgcggctgcaccgacttcgcgcgcggctgaacgcggtggcttttgggctcctgctgctt
ctagtccacggccaagggcccgaaattgttcagcctgaagtagacaccaccctgggtcgt
gtgcgaggccggcaggtgggcgtgaagggcacagaccgccttgtgaatgtctttctgggc
attccatttgcccagccgccactggggcctgaccgcttctcagccccacacccagcacag
ccctgggagggtgtgcgggatgccagcgccgcgcccccaatgtgcctacaagacgtggag
agcatgaacaacagcagatttgtcctcaacggaaaacagcagatcttctctgtttcagag
gactgcctggtcctcaacatctatagcccagctgaggccaccgcaggggccggcaggccg
gtcatggtatgggtccatggaggcgctctgataactggcgctgccacctcctacgatgga
tcagccctggctgcctatggggatgtggtcgtggttacagtccagtatcgccttggggtc
cttggcttcttcagcactggagatgagcatgcacctggcaaccagggcttcctggatgtg
gtagctgctctgcgctgggtgcaaggaaacatcacccccttcgggggtgacctcaactgt
gtcaccgtctttggtggatccgccggtggaagcatcgtctctggcctggtcctgtccccg
atggctgcagggctgttccacagagccatcacacagagtggggtcatcaccaccccaggg
atcatcgagtctcacccctggcccctagctcagaaaatcacaaacaccttggcctgcagc
tccagctccccggctgagatggtgcagtgccttcggcagaaggaaggagaagagctggtc
cttagcaagaagctgaaaagtactatctatcctctcaccgttgatggcactgtcttcccc
aaaagccccaaagaactcctgaaggagaagcccttccactcggtgcccttcctcatgggt
gtcaacaaccatgagttcagctggctcatccccaggggctggggtctcctggatacaatg
gagcagatgagccgggaggacatgctggccatctcaacacccgtcttgaccagtctggat
gtgccccctgagatgatgcccaccgtcatagatgaatacctaggcagcaactcggacgca
caagccaaatgcctggcgttccaggaattcatgggtgacgtattcatcaacgttcccacc
gtcagtttttcaagataccttcgagattctggaagccctgtctttttctatgagttccag
catcgacccagttcttttgcgaagatcaaacccgcctgggtgaaggcggatcatgcggct
gagggtgcttttgtgttcggaggtcccttcctcatggacgagagctcccgcctggccttt
ccagaggccacagaggaggaaaagcagctaagcctcaccatgatggcccagtggacccac
tttgcccggacaggggaccccaatagcaagggtctgcctcctcggccccgattcaaccag
gcggaacaatatctggagatcaacccagtgccacgggccggacagaagttcagggagacc
cggatgcagttctggtcagagacgctccccagcaagatacaacagtggcaccagaagcag
aagaacaggaaggcccaggaggacctctga

DBGET integrated database retrieval system