KEGG   Pongo abelii (Sumatran orangutan): 100172183Help
Entry
100172183         CDS       T01416                                 

Gene name
PDIA2
Definition
(RefSeq) protein disulfide-isomerase A2 precursor
  KO
K09581  protein disulfide isomerase family A, member 2 [EC:5.3.4.1]
Organism
pon  Pongo abelii (Sumatran orangutan)
Brite
Enzymes [BR:pon01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.4  Transposing S-S bonds
    5.3.4.1  protein disulfide-isomerase
     100172183 (PDIA2)
Chaperones and folding catalysts [BR:pon03110]
 Protein folding catalysts
  Protein disulfide isomerase
   100172183 (PDIA2)
Membrane trafficking [BR:pon04131]
 Endoplasmic reticulum (ER) - Golgi transport
  Forward pathways
   PDI family proteins
    100172183 (PDIA2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Thioredoxin Thioredoxin_6 OST3_OST6 Thioredoxin_2 Thioredoxin_7 AhpC-TSA Thioredoxin_8 Redoxin HyaE
Motif
Other DBs
NCBI-GeneID: 100172183
NCBI-ProteinID: NP_001125285
Ensembl: ENSPPYG00000006904
UniProt: Q5RCH2
Position
16
AA seq 525 aa AA seqDB search
MSCQLLPVLLLLLLRASCPWGHEQGPRSPSEEPPEEEIPKEDGILVLSRHTLGLALREHP
ALLVEFYAPWCGHCQALAPEYSKAAAVLAAESSVVMLAKVDGPAQPELAEEFGVTEYPTL
KFFRDGNRTHPEEYTGPREAEGIAEWLRRRVGPSAMRLEDEAAAQALIDGRDLVVIGFFQ
DLHDEDVATFLALAQDALDMTFGLTDRPQLFQQFGLTKDTVVLFKKFDEGRADFPVDEEL
GLDLGDLSRFLVTHSMRLVTEFNSQTSAKIFAARILNHLLLFVNQTLAAHRELLVGFGEA
APHFRGQVLFVVVDVAADNEHVLQYFGLKAEAAPTLRLVNLETTKKYAPVDGGPVTTASI
TAFCHAVLNGQVKPYLLSQEVPPDWDQRPVKTLVGKNFEQVAFDETKNVFVKFYAPWCTH
CKEMAPAWEALAEKYQDHEDVIIAELDATANELDAFAVHGFPTLKYFPAGPGRKVIEYKS
TRDLGTFSKFLDNGGVLPTEEPLEEPAAPFPEPPANSTMGSKEEL
NT seq 1578 nt NT seq  +upstreamnt  +downstreamnt
atgagctgccagcttctgcctgtgctgctgctgctgctgctcagggcttcgtgcccatgg
ggtcacgaacagggacccaggagcccctcggaggagcctccagaggaggaaatccccaag
gaggatgggatcttggtgctgagccgccacaccctgggcctggccctgcgggagcaccct
gccctgctggtggaattctacgccccgtggtgtgggcactgccaggccctggcccccgag
tacagcaaggcagctgccgtgctcgcggccgagtcgtcggtggtcatgctggctaaggtg
gatgggcccgcgcagcccgagctggctgaggagtttggtgtgacggagtaccctacgctc
aagttcttccgcgatgggaaccgcacgcacccggaggagtacacaggaccacgggaggct
gagggcattgccgagtggctgcgacggcgggtggggcccagtgccatgcggctggaggac
gaggcagctgcccaggcgctgatcgacggccgggacctggtggtcatcggcttcttccag
gacctgcacgacgaggatgtggccaccttcttggccttggcccaggatgccctggacatg
acctttggcctcacagaccggccgcagctctttcagcagtttggcctcaccaaggacact
gtggttctcttcaagaagtttgatgaggggcgggcagacttcccagtggacgaggagctt
ggcctggacctgggggatctgtcgcgcttcctggtcacacacagcatgcgcctggtcacg
gagttcaacagccagacgtctgccaagatcttcgcggccaggatcctcaaccatttgctg
ctgtttgtcaaccagacgctggctgcgcaccgggagctcctagtgggctttggggaggca
gctccccacttccgggggcaggtgttgttcgtggtggtggatgtggcggctgacaatgag
cacgtgctgcagtattttggcctaaaggctgaggcagcccccaccctgcgcttggtcaac
cttgagaccactaaaaagtacgcgcctgtggatgggggccctgtcaccacagcgtccatc
actgctttctgccatgcagtcctcaacggtcaagtcaagccctatctcctgagccaggag
gtaccccctgattgggatcagcggccagttaagaccctcgtgggcaagaattttgagcag
gtggcttttgacgaaaccaagaatgtgtttgtcaagttctatgctccatggtgcacccac
tgcaaggagatggcccctgcctgggaggcactggctgagaagtaccaagaccacgaggat
gtcatcattgctgagctggacgccacggccaatgagctggacgccttcgccgtgcacggc
ttccctaccctcaagtacttcccagcagggccaggtcggaaggtgattgaatacaaaagc
accagggacctggggaccttctccaagttcctggacaacgggggcgtgttgcccacggag
gagcccctggaggagccggcagccccgttcccggagccaccggccaactccactatgggg
tccaaggaggagctgtag

DBGET integrated database retrieval system