KEGG   Pongo abelii (Sumatran orangutan): 100172183Help
Entry
100172183         CDS       T01416                                 

Gene name
PDIA2
Definition
protein disulfide isomerase family A, member 2 (EC:5.3.4.1)
Orthology
K09581  
protein disulfide isomerase family A, member 2 [EC:5.3.4.1]
Organism
pon  Pongo abelii (Sumatran orangutan)
Brite
Enzymes [BR:pon01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.4  Transposing S-S bonds
    5.3.4.1  protein disulfide-isomerase
     100172183 (PDIA2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Ensembl: 
UniProt: 
Position
16
AA seq 525 aa AA seqDB search
MSCQLLPVLLLLLLRASCPWGHEQGPRSPSEEPPEEEIPKEDGILVLSRHTLGLALREHP
ALLVEFYAPWCGHCQALAPEYSKAAAVLAAESSVVMLAKVDGPAQPELAEEFGVTEYPTL
KFFRDGNRTHPEEYTGPREAEGIAEWLRRRVGPSAMRLEDEAAAQALIDGRDLVVIGFFQ
DLHDEDVATFLALAQDALDMTFGLTDRPQLFQQFGLTKDTVVLFKKFDEGRADFPVDEEL
GLDLGDLSRFLVTHSMRLVTEFNSQTSAKIFAARILNHLLLFVNQTLAAHRELLVGFGEA
APHFRGQVLFVVVDVAADNEHVLQYFGLKAEAAPTLRLVNLETTKKYAPVDGGPVTTASI
TAFCHAVLNGQVKPYLLSQEVPPDWDQRPVKTLVGKNFEQVAFDETKNVFVKFYAPWCTH
CKEMAPAWEALAEKYQDHEDVIIAELDATANELDAFAVHGFPTLKYFPAGPGRKVIEYKS
TRDLGTFSKFLDNGGVLPTEEPLEEPAAPFPEPPANSTMGSKEEL
NT seq 1578 nt NT seq  +upstreamnt  +downstreamnt
atgagctgccagcttctgcctgtgctgctgctgctgctgctcagggcttcgtgcccatgg
ggtcacgaacagggacccaggagcccctcggaggagcctccagaggaggaaatccccaag
gaggatgggatcttggtgctgagccgccacaccctgggcctggccctgcgggagcaccct
gccctgctggtggaattctacgccccgtggtgtgggcactgccaggccctggcccccgag
tacagcaaggcagctgccgtgctcgcggccgagtcgtcggtggtcatgctggctaaggtg
gatgggcccgcgcagcccgagctggctgaggagtttggtgtgacggagtaccctacgctc
aagttcttccgcgatgggaaccgcacgcacccggaggagtacacaggaccacgggaggct
gagggcattgccgagtggctgcgacggcgggtggggcccagtgccatgcggctggaggac
gaggcagctgcccaggcgctgatcgacggccgggacctggtggtcatcggcttcttccag
gacctgcacgacgaggatgtggccaccttcttggccttggcccaggatgccctggacatg
acctttggcctcacagaccggccgcagctctttcagcagtttggcctcaccaaggacact
gtggttctcttcaagaagtttgatgaggggcgggcagacttcccagtggacgaggagctt
ggcctggacctgggggatctgtcgcgcttcctggtcacacacagcatgcgcctggtcacg
gagttcaacagccagacgtctgccaagatcttcgcggccaggatcctcaaccatttgctg
ctgtttgtcaaccagacgctggctgcgcaccgggagctcctagtgggctttggggaggca
gctccccacttccgggggcaggtgttgttcgtggtggtggatgtggcggctgacaatgag
cacgtgctgcagtattttggcctaaaggctgaggcagcccccaccctgcgcttggtcaac
cttgagaccactaaaaagtacgcgcctgtggatgggggccctgtcaccacagcgtccatc
actgctttctgccatgcagtcctcaacggtcaagtcaagccctatctcctgagccaggag
gtaccccctgattgggatcagcggccagttaagaccctcgtgggcaagaattttgagcag
gtggcttttgacgaaaccaagaatgtgtttgtcaagttctatgctccatggtgcacccac
tgcaaggagatggcccctgcctgggaggcactggctgagaagtaccaagaccacgaggat
gtcatcattgctgagctggacgccacggccaatgagctggacgccttcgccgtgcacggc
ttccctaccctcaagtacttcccagcagggccaggtcggaaggtgattgaatacaaaagc
accagggacctggggaccttctccaagttcctggacaacgggggcgtgttgcccacggag
gagcccctggaggagccggcagccccgttcccggagccaccggccaactccactatgggg
tccaaggaggagctgtag

DBGET integrated database retrieval system