KEGG   Pongo abelii (Sumatran orangutan): 100172265Help
Entry
100172265         CDS       T01416                                 

Gene name
RPA2
Definition
(RefSeq) replication protein A 32 kDa subunit
  KO
K10739  replication factor A2
Organism
pon  Pongo abelii (Sumatran orangutan)
Pathway
pon03030  DNA replication
pon03420  Nucleotide excision repair
pon03430  Mismatch repair
pon03440  Homologous recombination
pon03460  Fanconi anemia pathway
Module
pon_M00288  RPA complex
Brite
KEGG Orthology (KO) [BR:pon00001]
 Genetic Information Processing
  Replication and repair
   03030 DNA replication
    100172265 (RPA2)
   03420 Nucleotide excision repair
    100172265 (RPA2)
   03430 Mismatch repair
    100172265 (RPA2)
   03440 Homologous recombination
    100172265 (RPA2)
   03460 Fanconi anemia pathway
    100172265 (RPA2)
DNA replication proteins [BR:pon03032]
 Eukaryotic Type
  DNA Replication Elongation Factors
   RPA (replication protein A)
    100172265 (RPA2)
DNA repair and recombination proteins [BR:pon03400]
 Eukaryotic Type
  SSBR (single strand breaks repair)
   NER (nucleotide excision repair)
    RPA (replication factor A)
     100172265 (RPA2)
   MMR (mismatch exicision repair)
     100172265 (RPA2)
  DSBR (double strand breaks repair)
   HR (homologous recombination)
     100172265 (RPA2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: RPA_C tRNA_anti-codon
Motif
Other DBs
NCBI-GeneID: 100172265
NCBI-ProteinID: NP_001125362
Ensembl: ENSPPYG00000001651
UniProt: Q5RC43
Position
1
AA seq 343 aa AA seqDB search
MGREDRNKRSIREHRLAEARSTWELTGSAIRGKEFVAPEKSSQSGAVAAAFCGFPRFPQT
RTFSASLRRIVTKMWNSGFESYGSSSYGGAGGYTQSPGGFGSPAPSQAEKKSRARAQHIV
PCTISQLLSATLVDEVFRIGNVEISQVTIVGIIRHAEKAPTNIVYKIDDMTAAPMDVRQW
VDTDDASSENTVVPPETYVKVAGHLRSFQNKKSLVAFKIMPLEDMNEFTTHILEVINAHM
VLSKANSQPSAGRAPISNPGMSEAGNFGGNSFMPANGLTVAQNQVLNLIKACPRPEGLNF
QDLKNQLKHMSVSSVKQAMDFLSNEGHIYSTVDDDHFKSTDAE
NT seq 1032 nt NT seq  +upstreamnt  +downstreamnt
atgggcagagaagacaggaacaagcgtagcattcgtgagcaccgattggctgaagcgaga
agcacctgggagctgactggctccgccattcgcgggaaggagtttgtggcgcccgagaaa
agtagccagagcggcgcagtggcggccgccttctgtggttttccgcgattcccccagacc
cgaaccttctcggcctctttgcggagaatcgtgaccaagatgtggaacagtggattcgaa
agctatggcagctcctcatacgggggagccggcggctacacgcagtccccggggggcttt
ggatcgcccgcaccttctcaggccgaaaagaaatcaagagcccgagcccagcacattgtg
ccctgtactatatctcagctgctttctgccactttggttgatgaagtgttcagaattggg
aatgttgagatttcacaggtcactattgtggggatcatcagacatgcagagaaggctcca
accaacattgtttacaaaatagatgacatgacagctgcacccatggacgttcgccagtgg
gttgacacagatgacgccagcagtgaaaacactgtggttcctccagaaacatatgtgaaa
gtggcaggccacctgagatcttttcagaacaaaaagagcctggtagcctttaagatcatg
cccctggaggatatgaatgagttcaccacacatattctggaagtgatcaatgcacacatg
gtactaagcaaagccaacagccagccctcagcagggagagcacctatcagcaatccagga
atgagtgaagcagggaacttcggtgggaatagcttcatgccagcaaatggcctcactgtg
gcccaaaaccaggtgttgaatttgattaaggcttgtccaagacctgaagggttgaacttt
caggatcttaagaaccagctgaaacacatgtctgtatcctcagtcaagcaagctatggat
tttctgagcaatgaggggcacatctattctactgtagatgatgaccattttaaatccaca
gatgcagaataa

DBGET integrated database retrieval system