KEGG   Pongo abelii (Sumatran orangutan): 100172358Help
Entry
100172358         CDS       T01416                                 

Gene name
LYPLA1
Definition
lysophospholipase I (EC:3.1.2.-)
Orthology
K06128  
lysophospholipase I [EC:3.1.1.5]
Organism
pon  Pongo abelii (Sumatran orangutan)
Pathway
Glycerophospholipid metabolism
Choline metabolism in cancer
Brite
KEGG Orthology (KO) [BR:pon00001]
 Metabolism
  Lipid metabolism
   00564 Glycerophospholipid metabolism
    100172358 (LYPLA1)
 Human Diseases
  Cancers
   05231 Choline metabolism in cancer
    100172358 (LYPLA1)
Enzymes [BR:pon01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.5  lysophospholipase
     100172358 (LYPLA1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Ensembl: 
UniProt: 
Position
8
AA seq 230 aa AA seqDB search
MCGNNMSTPLPAIVPAARKATAAVIFLHGLGDTGHGWAEAFAGIRSSHIKYICPHAPVRP
VTLNMNMAMPSWFDIIGLSPDSQEDESGIKQAAENIKALIDQEVKNGIPSNRIILGGFSQ
GGALSLYTALTTQQKLAGVTALSCWLPLRASFPQGPIGGANRDISILQCHGDCDPLVPLM
FGSLTVEKLKTLVNPANVTFKTYEGMMHSSCQQEMMDVKQFIDKLLPPID
NT seq 693 nt NT seq  +upstreamnt  +downstreamnt
atgtgcggcaataacatgtcaaccccgctgcccgccatcgtgcccgccgcccggaaggcc
accgctgcggtgattttcctgcatggattgggagatactgggcacggatgggcagaagcc
tttgcaggtatcagaagttcacatatcaaatatatctgcccgcatgcgcctgttaggcct
gttacattaaatatgaacatggctatgccttcatggtttgatattattgggctttcacca
gattcacaggaggatgaatctgggattaaacaggcagcagaaaatataaaagctttgatt
gatcaagaagtgaagaatggcattccttctaacagaattattttgggagggttttctcag
ggaggagctttatctttatatactgcccttaccacgcagcagaaactggcaggtgtcact
gcactcagttgctggcttccacttcgggcttcctttccacagggtcctatcggtggtgct
aatagagatatttctatcctccagtgccacggggattgtgaccctttagttcccctgatg
tttggttctcttacggttgaaaaactaaaaacattggtgaatccagccaatgtgaccttt
aaaacctatgaaggtatgatgcacagttcgtgtcaacaggaaatgatggatgtcaagcaa
ttcattgataaactcctacctccaattgattga

DBGET integrated database retrieval system