KEGG   Pongo abelii (Sumatran orangutan): 100172368Help
Entry
100172368         CDS       T01416                                 

Gene name
CYP1A2
Definition
cytochrome P450, family 1, subfamily A, polypeptide 2 (EC:1.14.14.1)
Orthology
K07409  
cytochrome P450, family 1, subfamily A, polypeptide 2 [EC:1.14.14.1]
Organism
pon  Pongo abelii (Sumatran orangutan)
Pathway
Steroid hormone biosynthesis
Caffeine metabolism
Tryptophan metabolism
Linoleic acid metabolism
Retinol metabolism
Metabolism of xenobiotics by cytochrome P450
Drug metabolism - cytochrome P450
Metabolic pathways
Chemical carcinogenesis
Brite
KEGG Orthology (KO) [BR:pon00001]
 Metabolism
  Lipid metabolism
   00140 Steroid hormone biosynthesis
    100172368 (CYP1A2)
   00591 Linoleic acid metabolism
    100172368 (CYP1A2)
  Amino acid metabolism
   00380 Tryptophan metabolism
    100172368 (CYP1A2)
  Metabolism of cofactors and vitamins
   00830 Retinol metabolism
    100172368 (CYP1A2)
  Biosynthesis of other secondary metabolites
   00232 Caffeine metabolism
    100172368 (CYP1A2)
  Xenobiotics biodegradation and metabolism
   00980 Metabolism of xenobiotics by cytochrome P450
    100172368 (CYP1A2)
   00982 Drug metabolism - cytochrome P450
    100172368 (CYP1A2)
 Human Diseases
  Cancers
   05204 Chemical carcinogenesis
    100172368 (CYP1A2)
Enzymes [BR:pon01000]
 1. Oxidoreductases
  1.14  Acting on paired donors with incorporation of molecular oxygen
   1.14.14  With reduced flavin or flavoprotein as one donor, and incorporation of one atom of oxygen into the other donor
    1.14.14.1  unspecific monooxygenase
     100172368 (CYP1A2)
Cytochrome P450 [BR:pon00199]
 Cytochrome P450, animal type
  CYP1 family
   100172368 (CYP1A2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Ensembl: 
UniProt: 
Position
15
AA seq 516 aa AA seqDB search
MALSQSVPFSATELLLASAIFCLVFWVLKGLRPRVPKGLKSPPEPWGWPLLGHVLTLRKN
PHLALSRMSQRYGDVLQIRIGSTPVLVLSGLDTIRQALVRQGDDFKGRPDLYSSTLITDG
QSLTFSPDSGPVWAARRHLAQNALNTFSIASDPASSYSCYLEEHVSKEAEALISRLQELM
AGPGHFDPYNQVVVSVVNVIGAMCFGQHFPESSDEMLSLVKNTHEFVETASSGNPVDFFP
ILRYLPNPALQRFKAFNQRFLRFLRKTVQEHYQDFDKNSVQDIMGALFKYSKKGPRASGN
LIPQEKIVNLVNDIFGAGFDTVTTAISWSLMYLVTKPEIQRKIQKELDTMIGRGRRPRLS
DRPQLPYLKAFILETFRHSSFLPFTIPHSTTRDTTLNGFYIPKECCVFVNQWQVNHDPEL
WEDPSEFWPERFLTTDGTAINKPLSEKVMLFGMGKRRCIGEVLANWEVFLFLAILLQQLE
FSVPPGVKVDLTPIYGLTMKHARCEHVQARLRFSIK
NT seq 1551 nt NT seq  +upstreamnt  +downstreamnt
atggcattgtcccagtctgttcccttctcggccacagagcttctcctggcctctgccatc
ttctgcctggtattctgggtgctcaagggtttgaggcctcgggtccccaaaggcctgaaa
agtccaccagagccatggggctggcccttgctcgggcatgtgctgaccctgaggaagaac
ccgcacctggcactgtcaaggatgagccagcgctacggggacgtgctgcagatccgcatt
ggctccacgcccgtgctggtgctgagcggcctggacaccatccggcaggccctggtgcgg
cagggcgacgatttcaagggccggcctgacctctacagctccaccctcatcactgatggc
cagagcttgaccttcagcccagactctggaccagtgtgggctgcccgccggcacctggcc
cagaacgccctcaacaccttctccatcgcctctgacccagcttcctcatactcctgctac
ctggaggagcatgtgagcaaagaggctgaggccctgatcagcaggttgcaggagctgatg
gcagggcctgggcacttcgacccttacaatcaggtggtggtgtcagtggtcaacgtcatc
ggtgccatgtgcttcggacagcacttccctgagagcagtgatgagatgctcagcctcgtg
aagaacactcatgagttcgtggagactgcctcctccgggaaccccgtggacttcttcccc
atccttcgctacctgcctaaccctgcccttcagaggttcaaggccttcaaccagaggttc
ctgcggttcctgcggaaaacagtccaggagcactatcaggactttgacaagaacagtgtc
caggacatcatgggtgccctgttcaagtacagcaagaaggggcctagagccagtggcaac
ctcatcccccaggagaagattgtcaaccttgtcaatgacatctttggagcaggatttgac
acagtcacaacagccatctcctggagcctcatgtaccttgtgaccaaacctgagatacag
aggaagatccagaaggagctggacactatgattggcagggggcggcggccccggctctct
gacagaccccagctgccctacttgaaggccttcatcctggagaccttccgacactcctcc
ttcttgcccttcaccatcccccacagcacaacaagggacacaacgctgaacggcttctac
atccccaaggaatgctgtgtcttcgtaaaccagtggcaggtcaaccatgacccggaactg
tgggaggacccgtctgagttctggcccgagcggttcctcaccaccgatggcaccgccatt
aacaagcccttgagtgagaaggtgatgctgtttggcatgggcaagcgccggtgtatcggg
gaggtcctggccaactgggaggtcttcctcttcctggccatcctgctacagcaactggag
ttcagtgtgccgccgggcgtgaaagtcgacctgacccccatctacgggctgaccatgaag
cacgcccgctgtgaacacgtccaggcacggctgcgcttctccatcaagtga

DBGET integrated database retrieval system