KEGG   Pongo abelii (Sumatran orangutan): 100172428Help
Entry
100172428         CDS       T01416                                 

Gene name
METAP1
Definition
(RefSeq) methionyl aminopeptidase 1
  KO
K01265  
methionyl aminopeptidase [EC:3.4.11.18]
Organism
pon  Pongo abelii (Sumatran orangutan)
Brite
Enzymes [BR:pon01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.11  Aminopeptidases
    3.4.11.18  methionyl aminopeptidase
     100172428 (METAP1)
Peptidases [BR:pon01002]
 Metallo Peptidases
  Family M24
   100172428 (METAP1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GeneID: 
NCBI-ProteinID: 
Ensembl: 
UniProt: 
Position
4
AA seq 386 aa AA seqDB search
MAAVETRVCETDGCSSEAKLQCPTCIKLGIQGSYFCSQECFKGSWATHKLLHKKAKDEKA
KREVSSWTVEGDINTDPWAGYRYTGKLRPHYPLMPTRPVPSYIQRPDYADHPLGMSESEQ
ALKGTSQIKLLSSEDIEGMRLVCRLAREVLDIAAGMIKPGVTTEEIDHAVHLACIARNCY
PSPLNYYNFPKSCCTSVNEVICHGIPDRRPLQEGDIVNVDITLYRNGYHGDLNETFFVGE
VDDGARKLVQTTYECLMQAIDAVKPGVRYRELGNIIQKHAQANGFSVVRSYCGHGIHKLF
HTAPNVPHYAKNKAVGVMKSGHVFTIEPMICEGGWQDETWPDGWTAVTRDGKRSAQFEHT
LLVTDTGCEILTRRLDSARPHFMSQF
NT seq 1161 nt NT seq  +upstreamnt  +downstreamnt
atggcggccgtggagacgcgggtgtgcgagacagacggctgcagcagtgaggccaagctc
cagtgtcccacctgcatcaagctgggcatccagggctcgtacttctgctcgcaggaatgt
tttaaaggaagttgggctactcacaagttactacataagaaagcaaaagatgaaaaggca
aagcgagaagtgtcttcctggactgtggaaggtgatattaatactgacccatgggcaggt
tatcgatatactggtaaactcagaccacattatccactgatgccaacaaggccagtgcca
agttatattcaaagaccagattatgctgatcatcccttaggaatgtctgaatctgaacag
gctcttaaaggtacttctcagattaaattactctcatctgaagatatagaagggatgcga
cttgtatgtaggcttgctagagaagttttggatattgctgctggcatgattaaaccaggt
gtaactactgaagaaatagatcatgctgtacacttagcatgtattgcaagaaattgctac
ccttctcccctgaattattataatttcccaaagtcttgttgtacctcagtgaatgaagtc
atttgccatggaataccagacagacggcccttgcaagaaggtgacattgttaatgtggac
atcactctttatcgcaatggttatcatggggacctgaatgagacattttttgttggagaa
gtggatgatggagcacggaaacttgttcagaccacatatgagtgcctgatgcaagccatc
gatgcagtgaagcctggtgttcggtacagagaattgggaaacattatccagaagcatgcc
caagcaaatgggttttcagttgttcgaagctattgtggacatggaatccacaagcttttt
catacagctcccaatgtaccccactatgccaaaaataaagcagttggagtgatgaagtcg
ggccatgtatttacaattgagccaatgatttgtgaaggcggatggcaggatgaaacctgg
ccagatggttggactgcggtgacaagagacggaaagcggtctgctcagtttgagcacacc
ctcctggtcacagacactggctgcgaaatcctaacccggcgacttgacagtgcacggcct
cacttcatgtctcaattttaa

DBGET integrated database retrieval system