KEGG   Pongo abelii (Sumatran orangutan): 100172445Help
Entry
100172445         CDS       T01416                                 

Gene name
TPM1
Definition
(RefSeq) tropomyosin alpha-1 chain
  KO
K10373  tropomyosin 1
Organism
pon  Pongo abelii (Sumatran orangutan)
Pathway
pon04260  Cardiac muscle contraction
pon04261  Adrenergic signaling in cardiomyocytes
pon05206  MicroRNAs in cancer
pon05410  Hypertrophic cardiomyopathy (HCM)
pon05414  Dilated cardiomyopathy (DCM)
Brite
KEGG Orthology (KO) [BR:pon00001]
 Organismal Systems
  Circulatory system
   04260 Cardiac muscle contraction
    100172445 (TPM1)
   04261 Adrenergic signaling in cardiomyocytes
    100172445 (TPM1)
 Human Diseases
  Cancers
   05206 MicroRNAs in cancer
    100172445 (TPM1)
  Cardiovascular diseases
   05410 Hypertrophic cardiomyopathy (HCM)
    100172445 (TPM1)
   05414 Dilated cardiomyopathy (DCM)
    100172445 (TPM1)
Cytoskeleton proteins [BR:pon04812]
 Eukaryotic cytoskeleton proteins
  Actin filaments / Microfilaments
   Actin-binding proteins
    Tropomyosins
     100172445 (TPM1)
Exosome [BR:pon04147]
 Exosomal proteins
  Exosomal proteins of microglial cells
   100172445 (TPM1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Tropomyosin Tropomyosin_1 Laminin_II CLZ TMF_DNA_bd XhlA HOOK DUF1664 DUF745 Laminin_I
Motif
Other DBs
NCBI-GeneID: 100172445
NCBI-ProteinID: NP_001125533
Ensembl: ENSPPYG00000006534
UniProt: Q5RBC9
Position
15
AA seq 284 aa AA seqDB search
MDAIKKKMQMLKLDKENALDRAEQAEADKKAAEDRSKQLEEDIAAKEKLLRVSEDERDRV
LEELHKAEDSLLAAEEAAAKAEADVASLNRRIQLVEEELDRAQERLATALQKLEEAEKAA
DESERGMKVIESRAQKDEEKMEIQEIQLKEAKHIAEDADRKYEEVARKLVIIESDLERAE
ERAELSEGKCAELEEELKTVTNNLKSLEAQAEKYSQKEDKYEEEIKVLSDKLKEAETRAE
FAERSVTKLEKSIDDLEEKVAHAKEENLSMHQMLDQTLLELNNM
NT seq 855 nt NT seq  +upstreamnt  +downstreamnt
atggacgccatcaagaagaagatgcagatgctgaagctcgacaaggagaacgcgttggat
cgagctgagcaggcggaggcagacaagaaggcggcggaagacaggagcaagcagctcgag
gaggacatcgcggccaaggagaagttgctgcgggtgtcggaggacgagcgggaccgggtg
ctggaggagctgcacaaggcggaggacagcctcctggccgccgaagaggccgccgccaag
gctgaagccgatgtagcttctctgaacagacgcatccagctggttgaggaagagttggat
cgtgcccaggagcgtctggcaacagctttgcagaagctggaggaagctgagaaggcagca
gatgagagtgagagaggcatgaaagtcattgagagtcgagcccaaaaagatgaagaaaaa
atggaaattcaggagatccaactgaaagaggccaagcacattgctgaagatgccgaccgc
aaatatgaagaggtggcccgtaagctggtcatcattgagagcgacctggaacgtgcagag
gagcgggctgagctctcagaaggcaaatgtgccgagcttgaagaagaattgaaaactgtg
acgaacaacttgaagtcactggaggctcaggctgagaagtactcgcagaaggaagacaaa
tatgaggaagagatcaaggtcctttccgacaagctgaaggaggctgagactcgagctgag
tttgcggagaggtcagtaactaaattggagaaaagcattgatgacttagaagagaaagtg
gctcatgccaaagaagaaaaccttagtatgcatcagatgctggatcagactttactggag
ttaaacaacatgtga

DBGET integrated database retrieval system