KEGG   Pongo abelii (Sumatran orangutan): 100172445Help
Entry
100172445         CDS       T01416                                 

Gene name
TPM1
Definition
tropomyosin 1 (alpha)
Orthology
K10373  
tropomyosin 1
Organism
pon  Pongo abelii (Sumatran orangutan)
Pathway
Cardiac muscle contraction
Adrenergic signaling in cardiomyocytes
MicroRNAs in cancer
Hypertrophic cardiomyopathy (HCM)
Dilated cardiomyopathy
Brite
KEGG Orthology (KO) [BR:pon00001]
 Organismal Systems
  Circulatory system
   04260 Cardiac muscle contraction
    100172445 (TPM1)
   04261 Adrenergic signaling in cardiomyocytes
    100172445 (TPM1)
 Human Diseases
  Cancers
   05206 MicroRNAs in cancer
    100172445 (TPM1)
  Cardiovascular diseases
   05410 Hypertrophic cardiomyopathy (HCM)
    100172445 (TPM1)
   05414 Dilated cardiomyopathy (DCM)
    100172445 (TPM1)
Exosome [BR:pon04147]
 Exosomal proteins
  Exosomal proteins of microglial cells
   100172445 (TPM1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
15
AA seq 284 aa AA seqDB search
MDAIKKKMQMLKLDKENALDRAEQAEADKKAAEDRSKQLEEDIAAKEKLLRVSEDERDRV
LEELHKAEDSLLAAEEAAAKAEADVASLNRRIQLVEEELDRAQERLATALQKLEEAEKAA
DESERGMKVIESRAQKDEEKMEIQEIQLKEAKHIAEDADRKYEEVARKLVIIESDLERAE
ERAELSEGKCAELEEELKTVTNNLKSLEAQAEKYSQKEDKYEEEIKVLSDKLKEAETRAE
FAERSVTKLEKSIDDLEEKVAHAKEENLSMHQMLDQTLLELNNM
NT seq 855 nt NT seq  +upstreamnt  +downstreamnt
atggacgccatcaagaagaagatgcagatgctgaagctcgacaaggagaacgcgttggat
cgagctgagcaggcggaggcagacaagaaggcggcggaagacaggagcaagcagctcgag
gaggacatcgcggccaaggagaagttgctgcgggtgtcggaggacgagcgggaccgggtg
ctggaggagctgcacaaggcggaggacagcctcctggccgccgaagaggccgccgccaag
gctgaagccgatgtagcttctctgaacagacgcatccagctggttgaggaagagttggat
cgtgcccaggagcgtctggcaacagctttgcagaagctggaggaagctgagaaggcagca
gatgagagtgagagaggcatgaaagtcattgagagtcgagcccaaaaagatgaagaaaaa
atggaaattcaggagatccaactgaaagaggccaagcacattgctgaagatgccgaccgc
aaatatgaagaggtggcccgtaagctggtcatcattgagagcgacctggaacgtgcagag
gagcgggctgagctctcagaaggcaaatgtgccgagcttgaagaagaattgaaaactgtg
acgaacaacttgaagtcactggaggctcaggctgagaagtactcgcagaaggaagacaaa
tatgaggaagagatcaaggtcctttccgacaagctgaaggaggctgagactcgagctgag
tttgcggagaggtcagtaactaaattggagaaaagcattgatgacttagaagagaaagtg
gctcatgccaaagaagaaaaccttagtatgcatcagatgctggatcagactttactggag
ttaaacaacatgtga

DBGET integrated database retrieval system