KEGG   Pongo abelii (Sumatran orangutan): 100172513Help
Entry
100172513         CDS       T01416                                 

Gene name
SPHK2
Definition
sphingosine kinase 2 (EC:2.7.1.91)
Orthology
K04718  
sphingosine kinase [EC:2.7.1.91]
Organism
pon  Pongo abelii (Sumatran orangutan)
Pathway
Sphingolipid metabolism
Metabolic pathways
Calcium signaling pathway
VEGF signaling pathway
Fc gamma R-mediated phagocytosis
Tuberculosis
Module
Sphingosine degradation
Brite
KEGG Orthology (KO) [BR:pon00001]
 Metabolism
  Lipid metabolism
   00600 Sphingolipid metabolism
    100172513 (SPHK2)
 Environmental Information Processing
  Signal transduction
   04370 VEGF signaling pathway
    100172513 (SPHK2)
   04020 Calcium signaling pathway
    100172513 (SPHK2)
 Organismal Systems
  Immune system
   04666 Fc gamma R-mediated phagocytosis
    100172513 (SPHK2)
 Human Diseases
  Infectious diseases
   05152 Tuberculosis
    100172513 (SPHK2)
Enzymes [BR:pon01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.91  sphinganine kinase
     100172513 (SPHK2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
19
AA seq 244 aa AA seqDB search
MNGHLEAEEQQDQRLDQELTGSWGHRPRSTLVRAKAMAPPPPPLAASTPLLHSEFGSYPA
RGPRFALTLTSQALHIQRLRPKPEARPRGGLVPLAEVSGCCTLRSRSPSDSAAYFCIYTY
PRGRRGARRRATRTFRADGAATYEENRAEAQRWATALTCLLRGLPLPGDGEITPDLLPRP
PRLLLLVNPFGGRGLAWQWCKNHVLPMISEAGLSFNLIQTERQNHARELVQGLSLSAERA
PRSP
NT seq 735 nt NT seq  +upstreamnt  +downstreamnt
atgaatggacaccttgaagcagaggagcagcaggaccagaggttggaccaggagctgacc
gggagctggggccacaggcctaggagcaccctggtcagggctaaggccatggccccgccc
ccaccgccactggctgccagcaccccgctcctccatagcgagtttggctcctacccagcc
cgaggcccacgctttgccctcaccctcacatcgcaggccctgcacatacagcggctgcgc
cccaaacccgaagccaggccccggggtggcctggtcccgttggccgaggtctcaggctgc
tgcaccctgcgaagccgcagcccctcagactcagcggcctacttctgcatctacacctac
cctcggggccggcgcggggcccggcgcagagccactcgcaccttccgggcagatggggcc
gccacctacgaagaaaaccgtgccgaggcccagcgctgggccaccgccctcacctgtctg
ctccgaggactgccactgcccggggatggggagatcacccctgacctgctacctcggcct
ccccggttgctcctattggtcaatccctttggggggcggggcctggcctggcagtggtgt
aagaaccacgtgcttcccatgatctctgaagctgggctgtccttcaacctcatccagaca
gaacgacagaaccacgcccgggagctggtccaggggctgagcctgagtgctgaacgggct
cctagatcgccctga

DBGET integrated database retrieval system