KEGG   Pongo abelii (Sumatran orangutan): 100172629Help
Entry
100172629         CDS       T01416                                 

Gene name
UNC13B
Definition
unc-13 homolog B (C. elegans)
Orthology
K15293  
protein unc-13
Organism
pon  Pongo abelii (Sumatran orangutan)
Pathway
Synaptic vesicle cycle
Brite
KEGG Orthology (KO) [BR:pon00001]
 Organismal Systems
  Nervous system
   04721 Synaptic vesicle cycle
    100172629 (UNC13B)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Ensembl: 
Position
9
AA seq 1591 aa AA seqDB search
MSLLCVRVKRAKFQGSPDKFNTYVTLKVQNVKSTTVAVRGDQPSWEQDFMFEISRLDLGL
SVEVWNKGLIWDTMVGTVWIALKTIRQSDEEGPGEWSTLEAETLMKDDEICGTRNPTPHK
ILLDTRFELPFDIPEEEARYWTYKWEQINALGADNEYSSQEESQRKPLPTAAAQCSFEDP
DSAVDDRDSDYRSETSNSIPPPYHTTSQPNASVHQFPVPVRSPQQLLLQGSSRDSCNDSM
QSYDLDYPERRAISPTSSSRYGSSCNVSQGSSQLSELDQYHEQDDDHRERDSIHSCHSSH
SLSRDGQAGFGEQEKPLEMTGQVEKEAACEPKEMKEDATTHTPPDLVLQKDHFLSPQESF
PEENASSPFTQARAHWIRAVTKVRLQLQEIPDDGDPSLPQWLPEGPAGGLYGIDSMPDLR
RKKPLPLVSDLSLVQSRKAGITSAMATRTSLKDEELKSHVYKKTLQALIYPISCTTPHNF
EVWTATTPTYCYECEGLLWGIARQGMRCSECGVKCHEKCQDLLNADCLQRAAEKSCKHGA
EDRTQNIIMAMKDRMKIRERNKPEIFEVIRDVFTVNKAAHVQQMKTVKQSVLDGTSKWSA
KITITVVCAQGLQAKDKTGSSDPYVTVQVSKTKKRTKTIFGNLNPVWEEKFHFECHNSSD
RIKVRVWDEDDDIKSRVKQRLKRESDDFLGQTIIEVRTLSGEMDVWYNLEKRTDKSAVSG
AIRLQISVEIKGEEKVAPYHMQYTCLHENLFHYLTDIQGSGGVRIPEARGDDAWKVYFDE
TAQEIVDEFAMRYGIESIYQAMTHFACLSSKYMCPGVPAVMSTLLANINAYYAHTTASTN
VSACDRFAASNFGKERFVKLLDQLHNSLRIDLSTYRNNFPAGSPERLQDLKSTVDLLTSI
TFFRMKVQELQSPPRASQVVKDCVKACLNSTYEYIFNNCHDLYSRQYQLKQELPPEEQGP
SIRNLDFWPKLITLIVSIIEEDKNSYTPVLNQFPQELNVGKVSAEVMWHLFAQDMKYALE
EHEKDHLCKSADYMNLHFKVKWLHNEYVRDLPVLQGQVPEYPAWFEQFVLQWLDENEDVS
LEFLRGALERDKKDGFQQTSEHALFSCSVVDVFTQLNQSFEIIRKLECPDPSILAHYMRR
FAKTIGKVLMQYADILSKDFPAYCTKEKLPCILMNNMQQLRVQLEKMFEAMGGKELDLEA
ADSLKELQVKLNTVLDELSMVFGNSFQVRIDECVRQMADILGQVRGTGNASPDARASAAQ
DADSVLRPLMDFLDGNLTLFATVCEKTVLKRVLKELWRVVMNTMERMIVLPPFTDQTGTQ
LIFTAAKELCHLSKLKDHMVREETRNLTPKQCAVLDLALDTIKQYFHAGGNGLKKTFLEK
SPDLQSLRYALSLYTQTTDTLIKTFVRSQTTQGCGVDDPVGEVSIQVDLFTHPGTGEHKV
TVKVVAANDLKWQTAGMFRPFVEVTMVGPHQSDKKRKFTTKSKSNNWAPKYNETFHFLLG
NEEGPESYELQICVKDYCFAREDRVLGLAVMPLRDVTAKGSCACWCPLGRKIHMDETGLT
ILRILSQRSNDEVAREFVKLKSESRSTEEGS
NT seq 4776 nt NT seq  +upstreamnt  +downstreamnt
atgtcactgctctgcgtgcgcgttaaaagggccaaattccagggttcaccagataaattt
aacacatatgtgaccctgaaagtacagaatgtgaagagcacaactgtagcagttcgtggt
gatcagccttcctgggaacaggatttcatgtttgagattagtcgcctggacctgggtcta
agtgtggaggtatggaacaaaggactgatctgggacaccatggtggggactgtgtggatt
gcgctgaagactattcgtcagtcggatgaggaagggcctggggaatggtccacattggag
gcagagacgttaatgaaagacgatgagatctgtggaactagaaacccaactcctcataaa
attttgcttgatacaagatttgagttgccttttgatatcccagaggaggaagccagatat
tggacctacaaatgggagcaaatcaatgccttgggagctgacaatgagtattctagtcaa
gaagaaagccagaggaagccattgcccactgctgccgcccagtgttcttttgaagaccct
gatagtgctgtcgatgaccgagatagtgactatcgcagtgagaccagcaacagcatccca
cctccttaccatacaacttcccagcccaacgcttctgtgcaccagttccctgtgccggtg
cgatcgccacagcagctgctacttcaaggcagttcccgggactcttgtaatgactctatg
caaagttatgaccttgattatccagagcggcgggctatcagccccaccagcagcagtagg
tatggctcctcctgtaatgtgagtcaaggaagctctcagctaagtgaactagaccagtat
catgaacaagatgacgaccatcgggagagggactcgattcattcttgccacagctctcac
agcctgtccagagatggccaagcaggttttggagaacaagagaaacccttggagatgaca
ggtcaagtagagaaggaggcagcatgtgaacccaaggagatgaaagaagatgccacaacc
cacactcccccagatctggtgctgcaaaaagaccacttcctaagtccccaggagagtttt
cctgaggagaatgcatcttcaccatttacccaagccagagcacattggatccgagcagtt
accaaggttcgactccagctgcaggagattccagatgatggtgacccctctctgcctcag
tggctcccggaagggccagccggagggctctatggcattgacagcatgccagatttacgc
agaaagaagccactgccacttgtcagtgatctgtcactggtccagtctcggaaggcagga
atcacttctgcaatggctacacgcacttctcttaaggacgaagagctgaaatcccatgtg
tataagaaaaccctgcaggccttaatctaccctatttcgtgcaccactcctcataacttt
gaggtctggacggccactaccccaacctactgctatgagtgtgaaggcctgctctggggc
attgcccggcaaggcatgcgctgcagcgaatgtggagtcaagtgccatgagaagtgccag
gatctgctcaatgctgactgcctgcagcgggctgcagaaaagagctgtaaacatggagct
gaggaccggacccagaacattatcatggccatgaaggaccgcatgaagatccgagagcga
aataagccagagatctttgaagttatccgggacgtcttcacagtgaacaaagctgcccac
gtgcagcagatgaaaacagtgaagcagagtgtactggatggcacctccaaatggtcggcc
aagatcaccattactgtggtgtgtgcccagggcctacaagccaaggacaaaacaggatcc
agtgacccttacgtgactgtgcaagtcagcaagactaagaagcgtaccaagaccattttt
ggaaacttgaatcctgtttgggaggaaaagttccattttgagtgccacaactcctctgac
cgcattaaggtgcgtgtgtgggatgaggatgatgacatcaagtcaagagtaaagcaacgc
ctaaagcgagagtccgatgatttccttggccaaaccatcattgaggttcggaccctaagc
ggcgagatggacgtctggtacaacttggagaagaggacagacaaatccgccgtctcaggg
gctatccgactacaaatcagtgtggagatcaagggggaggagaaagtagccccataccac
atgcagtacacgtgcctccatgagaatcttttccattacctcacagacattcagggcagt
ggaggagtccgcatccctgaagctcgaggagacgatgcctggaaggtgtactttgatgag
acagcccaagaaattgtggatgaatttgccatgcgttatggcattgagtccatatatcag
gccatgacgcactttgcatgtttatcatccaagtacatgtgtcctggtgtgccagcagtg
atgagcaccttactggccaacatcaatgcctactatgcccacacaactgcctctaccaat
gtctctgcatgtgatcgctttgcagcctccaactttggcaaagagagatttgtaaaactg
ctggaccagctacacaactcactgaggatcgacctctctacatacaggaataatttccct
gctgggagtcctgaacggcttcaggacttaaaatccacagtggatttgctgaccagcatt
actttcttcagaatgaaggtacaagaactgcaaagccctccaagagccagccaggtggta
aaggattgtgtgaaggcctgtttgaactccacatatgaatatatcttcaacaactgccac
gacttatacagccgccagtaccagctgaagcaagagctacctccagaggaacaagggccc
agcattcggaacctggatttctggcccaagctcatcacactcatcgtgtcaatcatagag
gaagataagaattcctacacacctgttctgaaccagtttcctcaggagttgaatgtggga
aaagtcagcgcagaggtgatgtggcatctgtttgcccaagacatgaaatatgcattggag
gagcatgagaaagaccacctgtgtaaaagtgctgactacatgaacctgcacttcaaggtg
aaatggctccacaatgaatatgtgcgggatctgcctgtcctccaggggcaggtgcctgag
tacccagcgtggtttgagcagtttgtgctacaatggctggatgagaatgaggatgtatcc
ctggaattcctgcgtggggccctggaacgagataagaaggatggattccagcagacatca
gagcatgcactcttttcctgctctgtggtggatgtcttcacacaactcaatcagagcttt
gagatcatccggaagctggaatgcccagaccccagcatccttgcccactacatgaggagg
tttgctaagaccattgggaaggtgctgatgcagtatgcagacatcttgtcaaaggacttc
ccagcctattgcacaaaggagaaactgccctgcatcctgatgaacaacatgcagcaactg
agggtccagctggagaaaatgtttgaggccatgggaggcaaggagctggaccttgaagct
gcagacagtctgaaggagctgcaggtgaaactgaatacagttctggatgagctcagcatg
gtgtttggaaacagtttccaggtacggattgatgagtgtgttcgacaaatggccgacatc
ctgggccaggttcggggcacagggaatgcatctccagacgccagggcctcagcggctcag
gatgcagatagcgtactccggcctctcatggacttcctggatggcaacctcaccctcttt
gccactgtgtgtgagaagacggttctgaagcgtgtactgaaggagctctggcgcgtggtg
atgaacacaatggagaggatgatcgttctgcccccattcactgaccagacgggcacccag
ctgatcttcactgctgccaaggagctgtgccatctttccaaactcaaggatcacatggtg
cgagaggaaacacggaatctcactccaaagcagtgtgcagtccttgacctcgccctggac
accatcaagcaatacttccatgcaggaggcaatgggctgaagaaaaccttcctggagaag
agcccagatctgcagtctctacgctatgccctgtctctatacacacagactactgacact
ctcatcaagacctttgtgcgctcgcagaccacccaagggtgtggtgtggacgatcctgtg
ggagaagtctctattcaggtggacttgtttacacaccctggtactggggagcacaaggtc
acagtgaaagtggtggctgccaatgacctcaagtggcagacagcgggtatgttccggcct
ttcgtggaggtgaccatggttggcccacaccaaagtgataagaagaggaagttcacaacc
aaatccaaaagcaacaactgggcccccaagtacaatgagacattccacttcctcctggga
aatgaagaggggcccgagtcctatgagttgcagatatgcgtgaaggattactgctttgcc
cgggaagatcgcgtgctagggctggctgtgatgcctctgagggatgtcacagccaagggc
agctgtgcctgctggtgccccttgggccggaagatccacatggatgagacaggcctgacc
attctccggattttgtctcagaggagcaatgacgaggtggcccgagaatttgtgaaactc
aaatcagagtctcgttccacagaggaggggagctga

DBGET integrated database retrieval system