KEGG   Pongo abelii (Sumatran orangutan): 100172651Help
Entry
100172651         CDS       T01416                                 

Gene name
PLA2G15, LYPLA3
Definition
phospholipase A2, group XV (EC:2.3.1.-)
Orthology
K06129  
lysophospholipase III [EC:3.1.1.5]
Organism
pon  Pongo abelii (Sumatran orangutan)
Pathway
Glycerophospholipid metabolism
Lysosome
Class
Metabolism; Lipid metabolism; Glycerophospholipid metabolism [PATH:pon00564]
Cellular Processes; Transport and catabolism; Lysosome [PATH:pon04142]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Ensembl: 
UniProt: 
Position
16
AA seq 412 aa AA seqDB search
MGLHLRPYRVGLLPDGLLFLLLLLMLLADPALPAGRHPPVVLVPGDLGNQLEAKLDKPTV
VHYLCSKKTESYFTIWLNLELLLPVIIDCWIDNIRLVYNKTSRATQFPDGVDVRVPGFGK
TFSLEFLDPSKSSVGSYFHTMVESLVGWGYTRGEDVRGAPYDWRRAPNENGPYFLALREM
IEEMYQLYGGPVVLVAHSMGNMYTLYFLQRQPQAWKDKYIQAFVSLGAPWGGVAKTLRVL
ASGDNNRIPVIGPLKIREQQRSAVSTSWLLPYNYTWSPEKVFVQTPTINYTLRDYRKFFQ
DIGFEDGWLMRQDTEGLVEATMPPGVQLHCLYGTGVPTPDSFYYESFPDRDPKICFGDGD
GTVNLKSALQCQAWQSRQEHQVLLQELPGSEHIEMLANATTLAYLKRVLLGP
NT seq 1239 nt NT seq  +upstreamnt  +downstreamnt
atgggcctccacctccgcccctaccgtgtggggctgctcccggatggcctcctgttcctc
ttgctgctgctaatgctgctcgcggacccagcgctcccggccggacgtcaccccccagtg
gtgctggtccctggtgatttgggtaaccaactggaagccaagctggacaagccaacagtg
gtgcactacctctgctccaagaagactgaaagctacttcacaatttggctgaacctggaa
ctgctgctgcctgtcatcattgactgctggattgacaatatcaggctggtttacaacaaa
acatccagggccacccagtttcccgatggtgtggatgtacgtgtccctggctttgggaag
accttctcactggagttcctggaccccagcaaaagcagcgtgggttcctatttccacacc
atggtggagagccttgtgggctggggctacacacggggtgaggatgtccgaggggctccc
tatgactggcgccgagccccaaatgaaaacgggccctacttcctggccctccgcgagatg
atcgaggagatgtaccagctgtatgggggccccgtggtgctggttgcccacagtatgggc
aacatgtacacgctctactttctgcagcggcagccgcaggcctggaaggacaagtatatc
caggccttcgtgtcactgggtgcgccctgggggggcgtggccaagaccctgcgcgtcctg
gcttcaggagacaacaaccggatcccagtcatcgggcccctgaagatccgggagcagcag
cggtcagctgtctccaccagctggctactgccctacaactacacatggtcacctgagaag
gtgttcgtgcagacacccacgatcaactacacactacgggactaccgcaagttcttccag
gacattggctttgaagatggctggcttatgcggcaggacacagaagggctggtggaagcc
acgatgccacctggcgtgcagctgcactgcctctatggcactggtgtccccacaccagac
tccttctactatgagagcttccctgaccgtgaccctaaaatctgctttggtgacggcgat
ggtactgtgaacttgaagagtgccctgcagtgccaggcctggcagagccgccaggagcac
caagtgttgctgcaggagttgccaggcagcgagcacatcgagatgctggccaacgccacc
accctggcctatctgaaacgtgtgctccttgggccctga

DBGET integrated database retrieval system