KEGG   Pongo abelii (Sumatran orangutan): 100172665Help
Entry
100172665         CDS       T01416                                 

Gene name
AOX1
Definition
aldehyde oxidase 1 (EC:1.2.3.1)
Orthology
K00157  
aldehyde oxidase [EC:1.2.3.1]
Organism
pon  Pongo abelii (Sumatran orangutan)
Pathway
Valine, leucine and isoleucine degradation
Tyrosine metabolism
Tryptophan metabolism
Vitamin B6 metabolism
Nicotinate and nicotinamide metabolism
Retinol metabolism
Drug metabolism - cytochrome P450
Metabolic pathways
Class
Metabolism; Amino acid metabolism; Valine, leucine and isoleucine degradation [PATH:pon00280]
Metabolism; Amino acid metabolism; Tyrosine metabolism [PATH:pon00350]
Metabolism; Amino acid metabolism; Tryptophan metabolism [PATH:pon00380]
Metabolism; Metabolism of cofactors and vitamins; Vitamin B6 metabolism [PATH:pon00750]
Metabolism; Metabolism of cofactors and vitamins; Nicotinate and nicotinamide metabolism [PATH:pon00760]
Metabolism; Metabolism of cofactors and vitamins; Retinol metabolism [PATH:pon00830]
Metabolism; Xenobiotics biodegradation and metabolism; Drug metabolism - cytochrome P450 [PATH:pon00982]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2B
AA seq 1338 aa AA seqDB search
MDRASELLFYVNGRKVIEKNVDPETMLLPYLRKKLRLTGTKYGCGGGGCGACTVMISRYN
PITKRIRHHPANACLIPICSLYGAAVTTVEGIGSTHTRIHPVQERIAKCHGTQCGFCTPG
MVMSIYTLLRNHPEPTLDQLTDALGGNLCRCTGYRPIIDACKTFCKTSGCCQSKENGVCC
LDQGINGLPEFEEGSKTSPKLFAEEEFLPLDPTQELIFPPELMIMAEKQSQRTRVFSGER
MMWFSPVTLKELLEFKFKYPQAPVVMGNTSVGPEVKFKGVFHPVIISPDRIEELSVVNHA
YNGLTLGAGLSLAQVKDILADVVQKLPEEKTQMYHALLKHLGTLAGSQIRNMASLGGHII
SRHPDSDLNPILAVGNCTLNLLSKEGKRQIPLNEQFLSKCPNADLKPQEILVSVNIPYSR
KWEFVSAFRQAQRQENALAIVNSGMRVFFGEGDGIIRELCISYGGVGPTTICAKNSCQKL
IGRCWNEEMLDTACRLVLDEVSLLGSAPGGKVEFKRTLIISFLFKFYLEVSQILKKMDPV
HYPSLADKYESSLEDLHSKHHCSTLKYQNIGPKQHPEDPIGHPIMHLSGVKHATGEAIYC
DDMPLVDQELFLTFVTSSRAHAKIVSIDLSEALSMPGVVDIMTAEHLGDVNSFCFFTEAE
KFLATDKVFCVGQLVCAVLADSEVQAKRAAKRVKIVYQDLEPLILTIEESIQHNSFFEPE
RKLEYGNVDEAFKVVDQILEGEIHMGGQEHFYMETQSMLVVPKGEDQEMDVYVSTQFPKY
IQDIVASTLKLPANKVMCHVRRVGGAFGGKVLKTGIIAAVTAFAANKHGRAVRCVLERGE
DMLITGGRHPYLGKYKAGFMDDGRILALDMEHYSNAGASLDESLFVIEMGLLKMDNAYKF
PNLRCRGWACRTNLPSNTAFRGFGFPQAALITESCITEVAAKCGLSPEKVRIINMYKEID
QTPYKQEINAKNLIQCWRECMAMSSYSLRKVAVEKFNAENYWKKKGLAMVPLKYPVGLGS
RAAGQAAALVHIYLDGSVLVTHGGIEMGQGVHTKMIQVVSRELRMPMSNVHLRGTSTETV
PNANISGGSVVADLNGLAVKDACQTLLKRLEPIISKNPKGTWKDWAQTAFDESISLSAVG
YFRGYESDMNWEKGEGHPFEYFVYGAACSEVEIDCLTGDHKNIGTDIVMDVGCSINPAID
VGQIGGAFIQGMGLYTIEELNYSPQGILHTRGPDQYKIPAICDMPTELHIVLLPPSQNSN
TLYSSKGLGESGVFLGCSVFFAIHDAVSAARQERGLHGPLSLNSPLTPEKIRMACEDKFT
KMIPRDEPGSYVPWNVPI
NT seq 4017 nt NT seq  +upstreamnt  +downstreamnt
atggaccgggcgtccgagctgctcttctacgtgaacggccgcaaggtgatagaaaaaaat
gtcgatcctgaaacaatgctgttgccttatttgaggaagaagcttcgactcacaggaact
aagtatggctgtggaggaggaggctgtggtgcttgtacagtgatgatatcacgatataac
cccatcaccaagaggataaggcatcacccagccaatgcctgtctgattcccatctgttct
ctgtatggtgctgccgtcaccacagtagaaggcataggaagcacccacaccagaattcat
cctgttcaggagaggatcgccaagtgtcacggcacccagtgtggcttctgcacacctggg
atggtgatgtccatctacacgctgctcaggaaccacccagagcccactctggatcagtta
actgatgcccttggtggtaacctgtgccgttgcactggatacaggcccataattgatgca
tgcaagactttctgtaaaacttcgggctgctgtcaaagtaaagaaaatggggtttgctgt
ttggatcaaggaatcaatggattgccagaatttgaggaaggaagtaagacaagtccaaaa
ctcttcgcagaagaggagtttctgccattggatccaacccaggaactgatatttcctcct
gagctaatgataatggctgagaaacagtcgcaaaggaccagagtgtttagcggtgagaga
atgatgtggttttcccccgtgaccctgaaggaactgctggaatttaaattcaagtatccc
caggcccctgttgtcatgggaaacacctctgtggggcctgaagtgaaatttaaaggcgtc
tttcacccagttataatttctcctgatagaattgaagaactgagtgttgtaaaccatgca
tataatggactcacccttggtgctggtctcagcctagcccaggtgaaggacattttggct
gatgtagtccagaagcttccagaggagaagacacagatgtaccatgctctcctgaagcat
ttgggaactctggctgggtcccagatcaggaacatggcttctttagggggacacatcatt
agcaggcatccagattcagatctgaatcccatcctggctgtgggtaactgtaccctcaac
ttgctatcaaaagaaggaaaacgacagattcctttaaatgagcaattcctcagcaagtgc
cctaatgcagatcttaagcctcaagaaatcttggtctcagtgaacatcccctactcaagg
aagtgggaatttgtgtcagccttccgacaagcccagcgacaggagaatgcgctagcgata
gtcaattcaggaatgagagtcttttttggagaaggggatggcattattagagagttatgc
atctcatatggaggcgttggtccaaccaccatctgtgccaagaattcctgccagaaactc
attggaaggtgctggaacgaagagatgctggatacagcctgcaggcttgttctggatgaa
gtctcccttttgggctcggcaccaggtgggaaggtggagttcaagaggactctcatcatc
agcttcctcttcaagttctacctggaagtgtcacagattttgaaaaagatggatccagtt
cactatcctagccttgcagacaaatatgaaagttctttagaagatcttcattccaaacat
cactgcagtacattaaagtaccagaatataggcccaaagcagcatcctgaagacccaatt
ggccaccccatcatgcatctctctggtgtgaagcatgccacgggggaggccatctactgt
gatgacatgcctctggtggaccaggaacttttcttgacttttgtgactagttcaagagct
catgctaagattgtgtctattgatctgtcagaagctctcagcatgcccggtgtggtggac
atcatgacagcagagcatcttggtgacgtcaactccttctgcttttttaccgaagctgag
aaatttctggcgacagataaggtgttctgtgtgggtcagcttgtctgtgccgtgcttgcc
gattctgaggttcaggcaaagcgagctgctaagcgagtgaagattgtctatcaagacttg
gagccgttgatactaacaatcgaggaaagtatacaacacaactccttcttcgagccagaa
aggaaactggaatatggaaatgttgacgaagcatttaaagtggttgatcaaattcttgaa
ggtgaaatacatatgggaggtcaagaacatttttatatggaaacccaaagcatgcttgtt
gttcccaagggagaggatcaagaaatggatgtctacgtgtccacacagtttcccaaatat
atacaggacattgttgcctcgaccttgaagctcccagctaacaaggtcatgtgccacgta
aggcgtgttggtggagcgtttggagggaaggtgttaaaaaccggaatcattgcagccgtc
actgcatttgccgcaaacaaacatggccgtgcagttcgctgtgttctggaacgaggagaa
gacatgttaataactggaggccgccatccttaccttggaaagtacaaagctggattcatg
gatgatggcagaatcttggccctggacatggagcattatagcaatgcaggtgcctccttg
gatgaatcattattcgtgatagaaatgggacttctgaaaatggacaatgcttacaagttt
cccaatctccgctgccggggttgggcatgcagaaccaaccttccatccaacacggctttt
cgtgggtttggctttcctcaggcagcgctgatcactgaatcttgtatcacagaggttgca
gccaaatgtggactatcccctgagaaggtgcgaatcataaacatgtacaaggaaattgat
caaacaccctacaaacaagagatcaatgccaagaacctgatccagtgttggagagaatgt
atggccatgtcttcctactccttgaggaaagttgctgtggaaaaattcaatgcagagaat
tattggaagaagaaaggactggccatggtccccctgaagtatcctgttggccttggctca
cgtgctgctggtcaggctgctgccttggttcacatttatcttgacggctctgtgctggtc
actcacggtggaattgaaatggggcagggggtccacactaaaatgattcaggtggtcagc
cgtgaattaagaatgccaatgtcgaatgtccacctgcgtggaacaagcacagaaaccgtc
cctaatgcaaatatctctggaggttctgtggtggcagatctcaacgggctggcagtaaag
gacgcctgtcaaactcttctaaaacgcctcgaacccatcatcagcaagaatcctaaagga
acttggaaagactgggcacagactgcttttgatgaaagcatcagcctttcagctgttgga
tacttcagaggttatgagtcagacatgaactgggagaaaggtgaaggccatcccttcgaa
tacttcgtttacggagctgcctgttctgaggttgaaatagactgcttgacgggggatcat
aagaacatcggaacagacattgtcatggatgttggctgcagtataaatccagccattgac
gtaggccagattggaggtgcatttattcaaggcatgggactttatacaatagaggaactg
aattattctccccagggcattctgcacactcgtggtccagaccaatataaaatccctgcc
atctgtgacatgcccacggagttgcacattgttttgttgcctccttctcaaaactcaaat
actctttattcatctaagggtctgggagagtcgggggtgttcctggggtgttccgtgttt
ttcgctatccatgacgcggtgagtgcagcacgacaggagagaggcctgcatggacccttg
agccttaatagtccactgaccccagagaagattaggatggcctgtgaagacaagttcaca
aaaatgattccgagagatgaacccggatcctatgttccttggaatgtacccatctga

DBGET integrated database retrieval system