KEGG   Pongo abelii (Sumatran orangutan): 100172665Help
Entry
100172665         CDS       T01416                                 

Gene name
AOX1
Definition
aldehyde oxidase 1 (EC:1.2.3.1)
Orthology
K00157  
aldehyde oxidase [EC:1.2.3.1]
Organism
pon  Pongo abelii (Sumatran orangutan)
Pathway
Valine, leucine and isoleucine degradation
Tyrosine metabolism
Tryptophan metabolism
Vitamin B6 metabolism
Nicotinate and nicotinamide metabolism
Retinol metabolism
Drug metabolism - cytochrome P450
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:pon00001]
 Metabolism
  Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    100172665 (AOX1)
   00350 Tyrosine metabolism
    100172665 (AOX1)
   00380 Tryptophan metabolism
    100172665 (AOX1)
  Metabolism of cofactors and vitamins
   00750 Vitamin B6 metabolism
    100172665 (AOX1)
   00760 Nicotinate and nicotinamide metabolism
    100172665 (AOX1)
   00830 Retinol metabolism
    100172665 (AOX1)
  Xenobiotics biodegradation and metabolism
   00982 Drug metabolism - cytochrome P450
    100172665 (AOX1)
Enzymes [BR:pon01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.3  With oxygen as acceptor
    1.2.3.1  aldehyde oxidase
     100172665 (AOX1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2B
AA seq 1338 aa AA seqDB search
MDRASELLFYVNGRKVIEKNVDPETMLLPYLRKKLRLTGTKYGCGGGGCGACTVMISRYN
PITKRIRHHPANACLIPICSLYGAAVTTVEGIGSTHTRIHPVQERIAKCHGTQCGFCTPG
MVMSIYTLLRNHPEPTLDQLTDALGGNLCRCTGYRPIIDACKTFCKTSGCCQSKENGVCC
LDQGINGLPEFEEGSKTSPKLFAEEEFLPLDPTQELIFPPELMIMAEKQSQRTRVFSGER
MMWFSPVTLKELLEFKFKYPQAPVVMGNTSVGPEVKFKGVFHPVIISPDRIEELSVVNHA
YNGLTLGAGLSLAQVKDILADVVQKLPEEKTQMYHALLKHLGTLAGSQIRNMASLGGHII
SRHPDSDLNPILAVGNCTLNLLSKEGKRQIPLNEQFLSKCPNADLKPQEILVSVNIPYSR
KWEFVSAFRQAQRQENALAIVNSGMRVFFGEGDGIIRELCISYGGVGPTTICAKNSCQKL
IGRCWNEEMLDTACRLVLDEVSLLGSAPGGKVEFKRTLIISFLFKFYLEVSQILKKMDPV
HYPSLADKYESSLEDLHSKHHCSTLKYQNIGPKQHPEDPIGHPIMHLSGVKHATGEAIYC
DDMPLVDQELFLTFVTSSRAHAKIVSIDLSEALSMPGVVDIMTAEHLGDVNSFCFFTEAE
KFLATDKVFCVGQLVCAVLADSEVQAKRAAKRVKIVYQDLEPLILTIEESIQHNSFFEPE
RKLEYGNVDEAFKVVDQILEGEIHMGGQEHFYMETQSMLVVPKGEDQEMDVYVSTQFPKY
IQDIVASTLKLPANKVMCHVRRVGGAFGGKVLKTGIIAAVTAFAANKHGRAVRCVLERGE
DMLITGGRHPYLGKYKAGFMDDGRILALDMEHYSNAGASLDESLFVIEMGLLKMDNAYKF
PNLRCRGWACRTNLPSNTAFRGFGFPQAALITESCITEVAAKCGLSPEKVRIINMYKEID
QTPYKQEINAKNLIQCWRECMAMSSYSLRKVAVEKFNAENYWKKKGLAMVPLKYPVGLGS
RAAGQAAALVHIYLDGSVLVTHGGIEMGQGVHTKMIQVVSRELRMPMSNVHLRGTSTETV
PNANISGGSVVADLNGLAVKDACQTLLKRLEPIISKNPKGTWKDWAQTAFDESISLSAVG
YFRGYESDMNWEKGEGHPFEYFVYGAACSEVEIDCLTGDHKNIGTDIVMDVGCSINPAID
VGQIGGAFIQGMGLYTIEELNYSPQGILHTRGPDQYKIPAICDMPTELHIVLLPPSQNSN
TLYSSKGLGESGVFLGCSVFFAIHDAVSAARQERGLHGPLSLNSPLTPEKIRMACEDKFT
KMIPRDEPGSYVPWNVPI
NT seq 4017 nt NT seq  +upstreamnt  +downstreamnt
atggaccgggcgtccgagctgctcttctacgtgaacggccgcaaggtgatagaaaaaaat
gtcgatcctgaaacaatgctgttgccttatttgaggaagaagcttcgactcacaggaact
aagtatggctgtggaggaggaggctgtggtgcttgtacagtgatgatatcacgatataac
cccatcaccaagaggataaggcatcacccagccaatgcctgtctgattcccatctgttct
ctgtatggtgctgccgtcaccacagtagaaggcataggaagcacccacaccagaattcat
cctgttcaggagaggatcgccaagtgtcacggcacccagtgtggcttctgcacacctggg
atggtgatgtccatctacacgctgctcaggaaccacccagagcccactctggatcagtta
actgatgcccttggtggtaacctgtgccgttgcactggatacaggcccataattgatgca
tgcaagactttctgtaaaacttcgggctgctgtcaaagtaaagaaaatggggtttgctgt
ttggatcaaggaatcaatggattgccagaatttgaggaaggaagtaagacaagtccaaaa
ctcttcgcagaagaggagtttctgccattggatccaacccaggaactgatatttcctcct
gagctaatgataatggctgagaaacagtcgcaaaggaccagagtgtttagcggtgagaga
atgatgtggttttcccccgtgaccctgaaggaactgctggaatttaaattcaagtatccc
caggcccctgttgtcatgggaaacacctctgtggggcctgaagtgaaatttaaaggcgtc
tttcacccagttataatttctcctgatagaattgaagaactgagtgttgtaaaccatgca
tataatggactcacccttggtgctggtctcagcctagcccaggtgaaggacattttggct
gatgtagtccagaagcttccagaggagaagacacagatgtaccatgctctcctgaagcat
ttgggaactctggctgggtcccagatcaggaacatggcttctttagggggacacatcatt
agcaggcatccagattcagatctgaatcccatcctggctgtgggtaactgtaccctcaac
ttgctatcaaaagaaggaaaacgacagattcctttaaatgagcaattcctcagcaagtgc
cctaatgcagatcttaagcctcaagaaatcttggtctcagtgaacatcccctactcaagg
aagtgggaatttgtgtcagccttccgacaagcccagcgacaggagaatgcgctagcgata
gtcaattcaggaatgagagtcttttttggagaaggggatggcattattagagagttatgc
atctcatatggaggcgttggtccaaccaccatctgtgccaagaattcctgccagaaactc
attggaaggtgctggaacgaagagatgctggatacagcctgcaggcttgttctggatgaa
gtctcccttttgggctcggcaccaggtgggaaggtggagttcaagaggactctcatcatc
agcttcctcttcaagttctacctggaagtgtcacagattttgaaaaagatggatccagtt
cactatcctagccttgcagacaaatatgaaagttctttagaagatcttcattccaaacat
cactgcagtacattaaagtaccagaatataggcccaaagcagcatcctgaagacccaatt
ggccaccccatcatgcatctctctggtgtgaagcatgccacgggggaggccatctactgt
gatgacatgcctctggtggaccaggaacttttcttgacttttgtgactagttcaagagct
catgctaagattgtgtctattgatctgtcagaagctctcagcatgcccggtgtggtggac
atcatgacagcagagcatcttggtgacgtcaactccttctgcttttttaccgaagctgag
aaatttctggcgacagataaggtgttctgtgtgggtcagcttgtctgtgccgtgcttgcc
gattctgaggttcaggcaaagcgagctgctaagcgagtgaagattgtctatcaagacttg
gagccgttgatactaacaatcgaggaaagtatacaacacaactccttcttcgagccagaa
aggaaactggaatatggaaatgttgacgaagcatttaaagtggttgatcaaattcttgaa
ggtgaaatacatatgggaggtcaagaacatttttatatggaaacccaaagcatgcttgtt
gttcccaagggagaggatcaagaaatggatgtctacgtgtccacacagtttcccaaatat
atacaggacattgttgcctcgaccttgaagctcccagctaacaaggtcatgtgccacgta
aggcgtgttggtggagcgtttggagggaaggtgttaaaaaccggaatcattgcagccgtc
actgcatttgccgcaaacaaacatggccgtgcagttcgctgtgttctggaacgaggagaa
gacatgttaataactggaggccgccatccttaccttggaaagtacaaagctggattcatg
gatgatggcagaatcttggccctggacatggagcattatagcaatgcaggtgcctccttg
gatgaatcattattcgtgatagaaatgggacttctgaaaatggacaatgcttacaagttt
cccaatctccgctgccggggttgggcatgcagaaccaaccttccatccaacacggctttt
cgtgggtttggctttcctcaggcagcgctgatcactgaatcttgtatcacagaggttgca
gccaaatgtggactatcccctgagaaggtgcgaatcataaacatgtacaaggaaattgat
caaacaccctacaaacaagagatcaatgccaagaacctgatccagtgttggagagaatgt
atggccatgtcttcctactccttgaggaaagttgctgtggaaaaattcaatgcagagaat
tattggaagaagaaaggactggccatggtccccctgaagtatcctgttggccttggctca
cgtgctgctggtcaggctgctgccttggttcacatttatcttgacggctctgtgctggtc
actcacggtggaattgaaatggggcagggggtccacactaaaatgattcaggtggtcagc
cgtgaattaagaatgccaatgtcgaatgtccacctgcgtggaacaagcacagaaaccgtc
cctaatgcaaatatctctggaggttctgtggtggcagatctcaacgggctggcagtaaag
gacgcctgtcaaactcttctaaaacgcctcgaacccatcatcagcaagaatcctaaagga
acttggaaagactgggcacagactgcttttgatgaaagcatcagcctttcagctgttgga
tacttcagaggttatgagtcagacatgaactgggagaaaggtgaaggccatcccttcgaa
tacttcgtttacggagctgcctgttctgaggttgaaatagactgcttgacgggggatcat
aagaacatcggaacagacattgtcatggatgttggctgcagtataaatccagccattgac
gtaggccagattggaggtgcatttattcaaggcatgggactttatacaatagaggaactg
aattattctccccagggcattctgcacactcgtggtccagaccaatataaaatccctgcc
atctgtgacatgcccacggagttgcacattgttttgttgcctccttctcaaaactcaaat
actctttattcatctaagggtctgggagagtcgggggtgttcctggggtgttccgtgttt
ttcgctatccatgacgcggtgagtgcagcacgacaggagagaggcctgcatggacccttg
agccttaatagtccactgaccccagagaagattaggatggcctgtgaagacaagttcaca
aaaatgattccgagagatgaacccggatcctatgttccttggaatgtacccatctga

  All links  
No link information was found.   
DBGET integrated database retrieval system