KEGG   Pongo abelii (Sumatran orangutan): 100172708Help
Entry
100172708         CDS       T01416                                 

Gene name
PCMT1
Definition
protein-L-isoaspartate (D-aspartate) O-methyltransferase (EC:2.1.1.77)
Orthology
K00573  
protein-L-isoaspartate(D-aspartate) O-methyltransferase [EC:2.1.1.77]
Organism
pon  Pongo abelii (Sumatran orangutan)
Class
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
6
AA seq 285 aa AA seqDB search
MPGARSGGSGGDGSNSGSYSGDASGAVTVWEVVSLLGKLLGTVVALKVVLYPLRVCLAMG
WKSGGASHSELIHNLRKNGIIKTDKVFEVMLATDRSHYAKCNPYMDSPQSIGFQATISAP
HMHAYALELLFDQLHEGAKALDVGSGSGILTACFARMVGCTGKVIGIDHIKELVDDSINN
VRKDDPTLLSSGRVQLVVGDGRMGYAEEAPYDAIHVGAAAPVVPQALIDQLKPGGRLILP
VGPAGGNQMLEQYDKLQDGSVKMKPLMGVIYVPLTDKEKQWSRWK
NT seq 858 nt NT seq  +upstreamnt  +downstreamnt
atgccgggagcgcgcagtggcggcagcggcggcgacggcagtaacagcggcagctacagc
ggggacgcgagcggggcggtgacggtgtgggaggtggtctcactcttgggaaaactgctg
ggcaccgtcgtcgcgctgaaggtggttctgtacccgctccgagtgtgcttagcgatgggc
tggaaatccggcggcgccagccactcggagctaatccacaatctccgcaaaaatggaatc
atcaagacagataaagtatttgaagtgatgctggctacagaccgctcccactatgcaaaa
tgtaacccatacatggattctccacaatcaataggtttccaagcaacaatcagtgctcca
cacatgcatgcatatgcgctagaacttctatttgatcagttgcatgaaggagctaaagct
cttgatgtaggatctggaagtggaatccttactgcatgttttgcacgtatggttggatgt
actggaaaagtcataggaattgatcacattaaagagctagtggatgactcaataaataat
gtcaggaaggacgatccaacacttctgtcttcagggagagtacagcttgttgtgggggat
ggaagaatgggatatgctgaagaagccccttatgatgccattcatgtgggagctgcagcc
cctgttgtaccccaggcgctaatagatcagttaaagcctggaggaagattgatattgcct
gttggtcctgcaggcggaaaccaaatgttggagcagtatgacaagctacaagatggcagc
gtcaaaatgaagcctctgatgggggtgatatacgtgcctttaacagataaagaaaagcag
tggtccaggtggaagtga

DBGET integrated database retrieval system