KEGG   Pongo abelii (Sumatran orangutan): 100172708Help
Entry
100172708         CDS       T01416                                 

Gene name
PCMT1
Definition
(RefSeq) protein-L-isoaspartate(D-aspartate) O-methyltransferase
  KO
K00573  protein-L-isoaspartate(D-aspartate) O-methyltransferase [EC:2.1.1.77]
Organism
pon  Pongo abelii (Sumatran orangutan)
Brite
Enzymes [BR:pon01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.77  protein-L-isoaspartate(D-aspartate) O-methyltransferase
     100172708 (PCMT1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: PCMT Methyltransf_25 Methyltransf_31 Methyltransf_11 Ubie_methyltran Methyltransf_23 GCD14 PrmA MTS FtsJ
Motif
Other DBs
NCBI-GeneID: 100172708
NCBI-ProteinID: NP_001125781
Ensembl: ENSPPYG00000017093
UniProt: Q5RA89
Position
6
AA seq 285 aa AA seqDB search
MPGARSGGSGGDGSNSGSYSGDASGAVTVWEVVSLLGKLLGTVVALKVVLYPLRVCLAMG
WKSGGASHSELIHNLRKNGIIKTDKVFEVMLATDRSHYAKCNPYMDSPQSIGFQATISAP
HMHAYALELLFDQLHEGAKALDVGSGSGILTACFARMVGCTGKVIGIDHIKELVDDSINN
VRKDDPTLLSSGRVQLVVGDGRMGYAEEAPYDAIHVGAAAPVVPQALIDQLKPGGRLILP
VGPAGGNQMLEQYDKLQDGSVKMKPLMGVIYVPLTDKEKQWSRWK
NT seq 858 nt NT seq  +upstreamnt  +downstreamnt
atgccgggagcgcgcagtggcggcagcggcggcgacggcagtaacagcggcagctacagc
ggggacgcgagcggggcggtgacggtgtgggaggtggtctcactcttgggaaaactgctg
ggcaccgtcgtcgcgctgaaggtggttctgtacccgctccgagtgtgcttagcgatgggc
tggaaatccggcggcgccagccactcggagctaatccacaatctccgcaaaaatggaatc
atcaagacagataaagtatttgaagtgatgctggctacagaccgctcccactatgcaaaa
tgtaacccatacatggattctccacaatcaataggtttccaagcaacaatcagtgctcca
cacatgcatgcatatgcgctagaacttctatttgatcagttgcatgaaggagctaaagct
cttgatgtaggatctggaagtggaatccttactgcatgttttgcacgtatggttggatgt
actggaaaagtcataggaattgatcacattaaagagctagtggatgactcaataaataat
gtcaggaaggacgatccaacacttctgtcttcagggagagtacagcttgttgtgggggat
ggaagaatgggatatgctgaagaagccccttatgatgccattcatgtgggagctgcagcc
cctgttgtaccccaggcgctaatagatcagttaaagcctggaggaagattgatattgcct
gttggtcctgcaggcggaaaccaaatgttggagcagtatgacaagctacaagatggcagc
gtcaaaatgaagcctctgatgggggtgatatacgtgcctttaacagataaagaaaagcag
tggtccaggtggaagtga

DBGET integrated database retrieval system