KEGG   Pongo abelii (Sumatran orangutan): 100172866Help
Entry
100172866         CDS       T01416                                 

Gene name
USP45
Definition
ubiquitin specific peptidase 45 (EC:3.4.19.12)
Orthology
K11844  
ubiquitin carboxyl-terminal hydrolase 16/45 [EC:3.1.2.15]
Organism
pon  Pongo abelii (Sumatran orangutan)
Brite
Enzymes [BR:pon01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.2  Thioester hydrolases
    3.1.2.15  ubiquitin thiolesterase
     100172866 (USP45)
Peptidases [BR:pon01002]
 Cysteine Peptidases
  Family C19: ubiquitin-specific protease family
   100172866 (USP45)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
6
AA seq 242 aa AA seqDB search
MRVKDPTKALPEKAKRSKRPTVPRDEDSSDDIAVGLTCQHVSHAISVNHVKRAIAENLWS
VCSECLKERRVYDGQLVLTSDIWLCLKCGFQGCGKNSESQHSLKHFKSSRTEPHCIIINL
STWIIWCYECDEKLSTHCNKKVLAQIVDFLQKHASKTQTSAFSRIMKLREEKCETDEIQK
GGKCRHLSVRGITNLGNTCFFNAVMQNLAQTYTLTDLMNEIKESSTKLKIFPSSDSQLGT
SI
NT seq 729 nt NT seq  +upstreamnt  +downstreamnt
atgcgggtgaaagatccaactaaagctttacctgagaaagccaaaagaagtaaaaggcct
actgtacctcgtgatgaagactcttcagatgatattgctgtaggtttaacttgccaacat
gtaagtcatgctatcagcgtgaatcatgtaaagagagcaatagctgagaatctgtggtca
gtttgctcagaatgtttaaaagaaagaagagtctatgatgggcagctagtacttacttct
gatatttggttgtgcctcaagtgtggcttccagggatgcggtaaaaactcagaaagccaa
cattcattgaagcacttcaagagttccagaacagagccgcattgtattataatcaatctg
agcacatggattatatggtgttatgaatgtgatgaaaaattatcaacacattgtaataag
aaggttttggctcagatagttgattttctccagaaacatgcttctaaaacacaaacaagt
gcattttctagaatcatgaaacttcgtgaagaaaaatgtgaaacagatgaaatacagaag
ggaggaaaatgcagacatttatctgtaagaggaattacaaatttaggaaacacttgcttt
tttaatgcagtcatgcagaacttggcacagacttatactcttactgatctgatgaatgag
atcaaagaaagtagtacaaaactcaagatttttccttcctcagactctcagctgggcacc
tcgatttaa

DBGET integrated database retrieval system