KEGG   Pongo abelii (Sumatran orangutan): 100172871Help
Entry
100172871         CDS       T01416                                 

Gene name
GYS1
Definition
(RefSeq) glycogen synthase 1
  KO
K00693  
glycogen synthase [EC:2.4.1.11]
Organism
pon  Pongo abelii (Sumatran orangutan)
Pathway
Starch and sucrose metabolism
Metabolic pathways
PI3K-Akt signaling pathway
AMPK signaling pathway
Insulin signaling pathway
Glucagon signaling pathway
Insulin resistance
Brite
KEGG Orthology (KO) [BR:pon00001]
 Metabolism
  Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    100172871 (GYS1)
 Environmental Information Processing
  Signal transduction
   04151 PI3K-Akt signaling pathway
    100172871 (GYS1)
   04152 AMPK signaling pathway
    100172871 (GYS1)
 Organismal Systems
  Endocrine system
   04910 Insulin signaling pathway
    100172871 (GYS1)
   04922 Glucagon signaling pathway
    100172871 (GYS1)
 Human Diseases
  Endocrine and metabolic diseases
   04931 Insulin resistance
    100172871 (GYS1)
Enzymes [BR:pon01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.11  glycogen(starch) synthase
     100172871 (GYS1)
Glycosyltransferases [BR:pon01003]
 Polysaccharide
  Storage polysaccharide
   100172871 (GYS1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
Ensembl: 
UniProt: 
Position
19
AA seq 737 aa AA seqDB search
MPLNRTLSMSSLPGLEDWEDEFDLENAVLFEVAWEVANKVGGIYTVLQTKAKVTGDEWGA
NYFLVGPYTEQGVRTQVELLEAPTPALKRTLDSMNSKGCKVYFGRWLIEGGPLVVLLDVG
ASAWALERWKGELWDTCNIGVPWYDREANDAVLFGFLTTWFLGEFLAQSEEKLHVVAHFH
EWLAGIGLCLCRARRLPVATIFTTHATLLGRYLCAGAVDFYNNLENFNVDKEAGERQIYH
RYCMERAAAHCAHVFTTVSQITAIEAQYLLKRKPDIVTPNGLNVKKFSAMHEFQNLHAQS
KARIQEFVRGHFYGHLDFNLDKTLYFFIAGRYEFSNKGADVFLEALARLNYLLRVNGSEQ
TVVAFFIMPARTNNFNVETLKGQAVRKQLWDTANTVKEKFGRKLYESLLVGSLPDMNKML
DKEDFTMMKRAIFATQRQSFPPVCTHNMLDDSSDPILTTIRRIGLFNSSADRVKVIFHPE
FLSSTSPLLPVDYEEFVRGCHLGVFPSYYEPWGYTPAECTVMGIPSISTNLSGFGCFMEE
HIADPSAYGIYILDRRFRSLDDSCSQLTSFLYSFCQQSRRQRIIQRNRTERLSDLLDWKY
LGRYYMSARHMALSKAFPEHFTYEPNEADAAQGYRYPRPASVPPSPSLSRHSSPHQSEDE
EDPRNGPLEEDGERYDEDEEAAKDRRNIRAPEWPRRASCTSSTSGSKRNSVDTATSSSLS
TPSEPLSPTSSLGEERN
NT seq 2214 nt NT seq  +upstreamnt  +downstreamnt
atgcctttaaaccgcactttgtccatgtcctcactgccaggactggaggactgggaggat
gaattcgacctggagaacgcagtgctcttcgaagtggcctgggaggtggctaacaaggtg
ggtggcatctacacggtgctgcagacgaaggcgaaggtgacgggggacgaatggggcgcc
aactacttcctggtggggccgtacacggagcagggcgtgaggacccaggtggaactgctg
gaggcccccaccccggccctgaagaggacactggattccatgaacagcaagggctgcaag
gtgtatttcgggcgctggctgatcgagggaggccctctggtggtgctcctggacgtgggt
gcctcagcttgggccctggagcgctggaagggagagctctgggatacctgcaacatcggg
gtgccgtggtacgaccgcgaggccaacgacgctgtcctctttggctttctgaccacctgg
ttcctgggtgagttcctggcgcagagtgaggagaagctacacgtggttgctcacttccat
gagtggttggcaggcattggactctgcctgtgtcgtgcccggcgactgcctgtagcaacc
atcttcaccacccatgccacgctgctggggcgctacctgtgtgccggtgccgtggacttc
tacaacaacctggagaacttcaacgtggacaaggaagcaggggagaggcagatctatcac
cgctactgcatggaaagggcggcagcccactgcgctcacgtcttcactactgtgtcccag
atcaccgccatcgaggcacagtacttgctcaagaggaaaccagatattgtgacccccaat
gggctgaatgtgaagaagttttctgccatgcatgagttccagaacctccatgctcagagc
aaggctcgaatccaggagtttgtgcggggccatttttatgggcatctggacttcaacttg
gacaagaccttgtacttctttatcgccggccgctatgagttctccaacaagggtgccgac
gtcttcctggaggccttggctcggctcaactatctgctcagagtgaacggcagcgagcag
acagtggttgccttcttcatcatgccagcgcggaccaacaatttcaacgtggaaaccctc
aaaggccaagccgtgcgcaaacagctttgggacacagccaacacggtgaaggaaaagttc
gggaggaagctttacgaatccttactggttgggagccttcccgacatgaacaagatgctg
gataaggaagacttcactatgatgaagagagccatctttgcaacgcagcggcagtctttc
ccccctgtgtgcacccacaatatgctggatgactcctcagaccccatcctgaccaccatc
cgccgaatcggcctcttcaatagcagtgccgacagggtgaaggtgattttccacccggag
ttcctctcctccacaagccccctgctccctgtggactatgaggagtttgtccgtggctgt
caccttggagtcttcccctcctactatgagccttggggctacacgccagctgagtgcacg
gttatgggaatccccagtatctccaccaatctctccggcttcggctgcttcatggaggaa
cacatcgcagacccctcagcttacggtatctacattctcgaccggcggttccgcagcctg
gatgattcttgctcgcagctcacctccttcctctacagcttctgtcagcagagccggcgg
cagcgtatcatccagcggaaccgcacggagcgcctctccgaccttctggactggaaatac
ctaggccggtactatatgtctgcgcgccacatggcgctgtccaaggcctttccagagcac
ttcacctacgagcccaacgaggcggatgcggcccagggttaccgctacccacggccagcc
tcggtgccaccgtcgccctcgctgtcacgacactccagcccgcaccagagtgaggacgag
gaggatccccggaacgggccgctggaggaagacggcgagcgctacgatgaggacgaggag
gccgccaaggaccggcgcaacatccgtgcaccagagtggccgcgccgagcatcctgcacc
tcctccaccagcgggagcaagcgcaactctgtggacacggccacctccagctcactcagc
accccgagcgagcccctcagccccaccagctccctgggcgaggagcgtaactaa

DBGET integrated database retrieval system