KEGG   Pongo abelii (Sumatran orangutan): 100172948Help
Entry
100172948         CDS       T01416                                 

Gene name
TPI1, TIM, TPI
Definition
triosephosphate isomerase 1 (EC:5.3.1.1)
Orthology
K01803  
triosephosphate isomerase (TIM) [EC:5.3.1.1]
Organism
pon  Pongo abelii (Sumatran orangutan)
Pathway
Glycolysis / Gluconeogenesis
Fructose and mannose metabolism
Inositol phosphate metabolism
Metabolic pathways
Carbon metabolism
Biosynthesis of amino acids
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Glycolysis, core module involving three-carbon compounds
Gluconeogenesis, oxaloacetate => fructose-6P
Brite
KEGG Orthology (KO) [BR:pon00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    100172948 (TPI1)
   01230 Biosynthesis of amino acids
    100172948 (TPI1)
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    100172948 (TPI1)
   00051 Fructose and mannose metabolism
    100172948 (TPI1)
   00562 Inositol phosphate metabolism
    100172948 (TPI1)
Enzymes [BR:pon01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.1  Interconverting aldoses and ketoses, and related compounds
    5.3.1.1  triose-phosphate isomerase
     100172948 (TPI1)
Exosome [BR:pon04147]
 Exosomal proteins
  Exosomal proteins of colorectal cancer cells
   100172948 (TPI1)
  Exosomal proteins of bladder cancer cells
   100172948 (TPI1)
  Exosomal proteins of melanoma cells
   100172948 (TPI1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
12
AA seq 249 aa AA seqDB search
MAPSRKFFVGGNWKMNGRKQSLGELIGTLNAAKVPADTEVVCAPPTAYIDFARQKLDPKI
AVAAQNCYKVTNGAFTGEISPGMIKDYGATWVVLGHSERRHVFGESDELIGQKVAHALAE
GLGVIACIGEKLDEREAGITEKVVFEQTKVIADNVKDWSKVVLAYEPVWAIGTGKTATPQ
QAQEVHEKLRGWLKSNVSDAVAQSTRIIYGGSVTGATCKELASQPDVDGFLVGGASLKPE
FVDIINAKQ
NT seq 750 nt NT seq  +upstreamnt  +downstreamnt
atggcgccctccaggaagttcttcgttggggggaactggaagatgaacgggcggaagcag
agcctgggggagctcatcggcactctgaacgcggccaaggtgccggccgacaccgaggtg
gtttgtgctccccctactgcctatatcgacttcgcccggcagaagctagatcccaagatt
gctgtggctgcgcagaactgctacaaagtgactaatggggcctttactggggagatcagc
cctggcatgatcaaagactacggagccacgtgggtggtcctggggcactcagagagaagg
catgtctttggggagtcagatgagctgattgggcagaaagtggcccatgctctggcagag
ggactcggagtaatcgcctgcattggggagaagctagatgaaagggaagctggcatcact
gagaaggttgtttttgagcagacaaaggtcatcgcagataatgtgaaggactggagcaag
gtcgtcctggcctatgagcctgtgtgggccattggtactggcaagactgcaacaccccaa
caggcccaggaagtacacgagaagctccgaggatggcttaagtccaacgtctctgatgcg
gtggctcagagcacccgtatcatttatggaggctctgtgactggggcaacctgcaaggag
ctggccagccagcctgacgtggatggcttccttgtgggtggtgcttccctcaagcccgaa
ttcgtggacatcatcaatgccaaacaatga

  All links  
No link information was found.   
DBGET integrated database retrieval system