KEGG   Pongo abelii (Sumatran orangutan): 100173147Help
Entry
100173147         CDS       T01416                                 

Gene name
TMX3, TXNDC10
Definition
thioredoxin-related transmembrane protein 3 (EC:5.3.4.1)
Orthology
K09585  
thioredoxin domain-containing protein 10 [EC:5.3.4.1]
Organism
pon  Pongo abelii (Sumatran orangutan)
Class
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
18
AA seq 454 aa AA seqDB search
MAAWKSWAALRLCATVVLLDMVVCKGFVEDLDESFKENRNDDIWLVDFYAPWCGHCKKLE
PIWNEVGLEMKSIGSPVKVGKMDATSYSSIASEFGVRGYPTIKLLKGDLAYNHRGPRTKD
DIIEFAHRVSGALIRPLPSQQMFEHMQKRHRVFFVYIGGESPLKEKYIDAASELIVYTYF
FSASEEVVPEYVTLKEMPAVLVFKDETYFVYDEYEDGDLSSWINRERFQNYLAMDGFLLY
ELGDTGKLVALAVIDEKNTSVEHTRLKSIIQEVARDYRDLFHRDFQFGHMDGNDYINTLL
MDELTVPTVVVLNTSNQQYFLLDRQIKNVEDMVQFINNILDGTVEAQGGDSILQRLKRIV
FDAKSTIVSIFKSSPLMGCFLFGLPLGVISIMCYGIYTADTDGGYIEERYEVSKSENENQ
EQIEESKEQQEPSSGGSVVPTVQEPKDVLEKKKD
NT seq 1365 nt NT seq  +upstreamnt  +downstreamnt
atggcagcgtggaagagttgggcggccctgcggctctgcgccacagttgttttacttgat
atggtcgtctgtaaaggatttgtagaagatttagatgaatcgtttaaagaaaatcgaaat
gatgacatttggcttgtagatttttatgcaccatggtgtggccattgtaaaaagctggaa
ccgatttggaatgaagttggtcttgagatgaaaagcattggttctccagttaaggttgga
aagatggatgctacttcctattctagcattgcttcagagtttggagttcgaggttatcca
acaattaagctattaaaaggggacttggcatataatcatagaggaccacgaacaaaagat
gatattattgagtttgctcacagagtatctggggctctaattcggccacttccaagtcaa
caaatgtttgaacatatgcagaagagacaccgtgtatttttcgtttatataggtggagaa
tcacctttgaaagagaaatacatagatgctgcttcagaattgattgtatatacatacttc
ttttctgcctcagaagaagtggttcctgagtatgtgacactaaaagagatgccagctgtg
cttgttttcaaagatgaaacttactttgtttatgacgagtatgaagatggtgatctgtca
tcatggatcaacagggaaaggtttcagaattaccttgctatggatggctttctcttgtat
gaacttggagacacaggaaagcttgtggctcttgcagttattgatgagaaaaatacatca
gttgaacataccagattgaagtcaattattcaggaagttgcaagagattacagagacctc
ttccatagggattttcagtttggccatatggatggaaatgactacataaataccttgctg
atggatgaattgacagtcccaactgtagttgtactgaatacttcaaaccaacaatatttc
ttgctagatagacagattaagaatgttgaagacatggtccagtttattaataacattttg
gatggcacagtagaagcccaaggaggtgatagcattttgcagagattgaaaagaatagta
tttgatgccaaatctactattgtgtctatattcaagagctcaccactgatgggctgcttt
ctctttggcctgccactgggtgtcatcagtatcatgtgttatggaatctacacagctgac
acagatggaggttatatagaagaacgatatgaagtgtctaaaagtgaaaatgaaaaccaa
gaacagatagaagagagcaaagaacagcaggagcccagcagtggaggatctgtagtgcct
acagtgcaggaacccaaggatgtattagaaaagaagaaagactga

DBGET integrated database retrieval system