KEGG   Pongo abelii (Sumatran orangutan): 100173242Help
Entry
100173242         CDS       T01416                                 

Gene name
MAPK6
Definition
mitogen-activated protein kinase 6 (EC:2.7.11.24)
Orthology
K06855  
mitogen-activated protein kinase 4/6 [EC:2.7.11.24]
Organism
pon  Pongo abelii (Sumatran orangutan)
Brite
Enzymes [BR:pon01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.24  mitogen-activated protein kinase
     100173242 (MAPK6)
Protein kinases [BR:pon01001]
 Serine/threonine protein kinases: CMGC group
  MAPK family [Table]
   100173242 (MAPK6)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Ensembl: 
UniProt: 
Position
15
AA seq 721 aa AA seqDB search
MAEKFESLMNIHGFDLGSRYMDLKPLGCGGNGLVFSAVDNDCDKRVAIKKIVLTDPQSVK
HALREIKIIRRLDHDNIVKVFEILGPSGSQLTDDVGSLTELNSVYIVQEYMETDLANVLE
QGPLLEEHARLFMYQLLRGLKYIHSANVLHRDLKPANLFINTEDLVLKIGDFGLARIMDP
HYSHKGHLSEGLVTKWYRSPRLLLSPNNYTKAIDMWAAGCIFAEMLTGKTLFAGAHELEQ
MQLILESIPVVHEEDRQELLSVIPVYIRNDMTEPHKPLTQLLPGISREALDFLEQILTFS
PMDRLTAEEALSHPYMSIYSFPMDEPISSHPFHIEDEVDDILLMDETHSHIYNWERYHDC
QFSEHDWPVHNNFDIDEVQLDPRALSDVTDEEEVQVDPRKYLDGDREKYLEDPAFDTNYS
TEPCWQYSDHHENKYCDLECGHTCNYKTRSSSYLDNLVWRESEVNHYYEPKLIIDLSNWK
EQSKEKSDKKGKSKCERNGLVKAQIALEEASQQLAGKEREKNQGFDFDSFIAGTIQLSSQ
HEPTDVVDKLNDLNSSVSQLELKSLISKSVSQEKQEKGMANLAQLEALYQSSWDSQFVNG
GEDCFFINQFCEVRKDEQVEKENTYTSYLDKFFSRKEDTEMLETEPVEDGKLGERGHEEG
FLNNSGEFLFNKQLESIGIPQFHSPVGSPLKSIQATLTPSAMKSSPQIPHQTYSSILKHL
N
NT seq 2166 nt NT seq  +upstreamnt  +downstreamnt
atggcagagaaatttgaaagtctcatgaacattcatggttttgatctgggttctaggtat
atggacttaaaaccattgggttgtggaggcaatggcctggttttttctgctgtagacaat
gactgtgacaaaagagtagccatcaagaaaattgtccttactgatccccagagtgtcaaa
catgctctacgtgaaatcaaaattattagaagacttgaccatgataacattgtgaaagtg
tttgaaattcttggtcccagtggaagccaattaacagacgatgtgggctctcttacggaa
ctgaacagtgtttacattgttcaggagtacatggagacagacttggctaatgtgctggag
cagggccctttactggaagagcatgccaggcttttcatgtatcagctgctacgggggctc
aagtatattcactctgcaaatgtactgcacagagatctcaaaccagctaatcttttcatt
aatactgaagacttggtgctgaagataggtgactttggtcttgcacggatcatggatcct
cattattcccataagggtcatctttctgaaggattggttactaaatggtacagatctcca
cgtcttttactttctcctaataattatactaaagccattgacatgtgggctgcaggctgc
atctttgctgaaatgctgactggtaaaaccctttttgcaggtgcacatgaacttgaacag
atgcagctgattttagaatctattcctgttgtacatgaggaagatcgtcaggagcttctc
agcgtaattccagtttacattagaaatgacatgactgagccacacaaacctttaactcag
ctgcttccaggaattagtcgagaagcactggatttcctggaacaaattttgacatttagc
cccatggatcggttaacagcagaagaagcactctcccatccttacatgagcatatattct
tttccaatggatgagccaatttcaagccatccttttcatattgaagatgaagttgatgat
attttgcttatggatgaaactcacagtcacatttataactgggaaaggtatcatgattgt
cagttttcagagcatgattggcctgtacataacaactttgatattgatgaagttcagctt
gatccaagagctctgtccgatgtcactgatgaagaagaagtacaagttgatccccgaaaa
tatttggatggagatcgggaaaagtacctggaggatcctgcttttgataccaattactct
actgagccttgttggcagtactcagatcatcatgaaaacaaatattgtgatctggagtgt
ggccatacttgtaactacaaaacgaggtcatcatcatatttagataacttagtttggaga
gagagtgaagttaaccattactatgaacccaagcttattatagatctttccaattggaaa
gaacaaagcaaagaaaaatctgataagaaaggcaaatcaaaatgtgaaaggaatggattg
gttaaagctcagatagcgctagaggaagcatcacagcaactggctggaaaagaaagggag
aagaatcagggatttgattttgattcctttattgcaggaactattcagcttagttcccag
catgagcctactgatgttgttgataaattaaatgacttgaatagctcagtgtcccaacta
gaattgaaaagtttgatatcaaagtcagtaagccaagaaaaacaggaaaaaggaatggca
aatctggctcaattagaagccttgtaccagtcttcttgggacagccagtttgtgaatggt
ggggaggactgttttttcataaatcagttttgtgaggtaaggaaggatgaacaagttgag
aaggaaaacacttacactagttacttggacaagttctttagcaggaaagaagatactgaa
atgctagaaactgagccagtagaggatgggaagcttggggagagaggacatgaggaagga
tttctgaacaacagtggggagttcctctttaacaagcagctcgagtccataggcatcccg
cagtttcacagtccagttgggtcaccacttaagtcaatacaggccacattaacaccttct
gctatgaaatcttcccctcaaattcctcatcaaacatacagcagcattctgaaacatctg
aactaa

DBGET integrated database retrieval system