KEGG   Pongo abelii (Sumatran orangutan): 100173272Help
Entry
100173272         CDS       T01416                                 

Gene name
GLB1
Definition
galactosidase, beta 1 (EC:3.2.1.23)
Orthology
K12309  
beta-galactosidase [EC:3.2.1.23]
Organism
pon  Pongo abelii (Sumatran orangutan)
Pathway
Galactose metabolism
Other glycan degradation
Glycosaminoglycan degradation
Sphingolipid metabolism
Glycosphingolipid biosynthesis - ganglio series
Metabolic pathways
Lysosome
Module
Keratan sulfate degradation
Brite
KEGG Orthology (KO) [BR:pon00001]
 Metabolism
  Carbohydrate metabolism
   00052 Galactose metabolism
    100173272 (GLB1)
  Lipid metabolism
   00600 Sphingolipid metabolism
    100173272 (GLB1)
  Glycan biosynthesis and metabolism
   00531 Glycosaminoglycan degradation
    100173272 (GLB1)
   00604 Glycosphingolipid biosynthesis - ganglio series
    100173272 (GLB1)
   00511 Other glycan degradation
    100173272 (GLB1)
 Cellular Processes
  Transport and catabolism
   04142 Lysosome
    100173272 (GLB1)
Enzymes [BR:pon01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.23  beta-galactosidase
     100173272 (GLB1)
Exosome [BR:pon04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   100173272 (GLB1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Ensembl: 
UniProt: 
Position
3
AA seq 677 aa AA seqDB search
MPGFLVRILPLLLALLLLGPTRGLRNATQRMFEIDYSRDCFLKDGQPFRYISGSIHYSRV
PRFYWKDRLLKMKMAGLNAIQTYVPWNFHEPWPGQYQFSEDHDVEYFLQLAHELGLLVIL
RPGPYICAEWEMGGLPAWLLEKESILLRSSDPDYLAAVDKWLGVLLPKMKPLLYQNGGPV
ITVQVENEYGSYFACDFDYLRFLQKCFRHHLGDDVVLFTTDGAHKTFLKCGALQGLYTTV
DFGTGSNITDAFLSQRKCEPKGPLINSEFYTGWLDHWGQPHSTIKTEAVASSLYDILARG
ASVNLYMFIGGTNFAYWNGANTPYAAQPTSYDYDAPLSEAGDLTEKYFALRNIIQKFEKV
PEGPIPPSTPKFAYGKVALEKLKTVGAALDILCPSGPIKSLYPLTFIQVKQHYGFVLYRT
TLPQDCSNPAPLSSPFNGVHDRAYVAVDGIPQGVLERNNVITLNITGKAGATLDLLVENM
GRVNYGAYINDFKGLVSNLTLSSNILTDWTIFPLDTEDAVRSHLGGWGHRDSGHHDEAWA
HSSSNYTLPAFYVGNFSIPSGIPDLPQDTFIQFPGWTKGQVWINGFNLGRYWPARGPQLT
LFVPQHILMTSAPNTITMLELERAPCSNDDPELCAVTFVDRPVIGSSVTYDHPSKPVEKR
LMPSPPQKNKDSWLDHV
NT seq 2034 nt NT seq  +upstreamnt  +downstreamnt
atgccggggttcctggttcgcatccttcctctgctgctggctctgctgcttctgggccct
acgcgcggcttgcgcaatgccacccagaggatgtttgaaattgactatagccgggactgc
ttcctcaaggatggccagccatttcgctacatctcaggaagcattcactactcccgcgtg
ccccgcttctactggaaggaccggctgctgaagatgaagatggctgggctgaatgccatc
cagacgtatgtgccctggaactttcatgagccctggccaggacagtaccagttttctgag
gaccatgatgtggaatattttcttcagctggctcatgagctgggactgctggttatcctg
aggcccgggccctacatctgtgcagagtgggaaatgggaggattacctgcttggctgcta
gagaaagagtctattctcctccgctcttccgatccagattacttggcagctgtggacaag
tggttgggagtccttctgcccaagatgaagcctctcctctatcagaatggagggccagtt
ataacagtgcaggttgaaaatgaatatggcagctactttgcctgtgattttgactacctg
cgcttcctgcagaagtgctttcgccaccatctgggggatgatgtggttctgttcaccact
gatggagcacataaaacattcctgaaatgtggggctctgcagggcctctacaccacagtg
gactttggaacaggcagcaacatcacagatgctttcctaagccagaggaagtgtgagccc
aaaggacccttgatcaattctgaattctatactggctggctagaccactggggccaacct
cattccacaatcaagaccgaagcagtggcttcctccctctatgatatacttgcccgtggg
gcaagtgtgaacttgtacatgtttataggtgggaccaattttgcctattggaatggggcc
aacacaccctatgcagcacagcccaccagctacgactatgatgccccactgagtgaggct
ggggacctcactgagaagtattttgctctgcgaaacattatccagaagtttgaaaaagta
ccagaaggtcctatccctccatctacaccaaagtttgcatatggaaaggtcgctctggaa
aagttaaagacagtgggagcagctctggacattctgtgtccctctgggcccatcaaaagc
ctttatcccttgacatttatccaggtgaaacagcattatgggtttgtgctgtaccggaca
acacttcctcaagattgcagcaacccagcacctctctcttcacccttcaatggagtccac
gatcgagcatatgttgctgtggatgggatcccccagggagtccttgagcgaaacaatgtg
atcactctgaacataacagggaaagctggagccactctggaccttctggtagagaacatg
ggacgtgtgaactatggtgcatatatcaatgattttaagggtttggtttctaacctgacc
ctcagttccaatattctcacggactggacgatctttccactggacactgaggatgcagtg
cgcagccacctggggggctggggacaccgtgacagtggccaccatgatgaagcctgggcc
cacagctcatccaactacacgctcccggccttttatgtggggaacttctccattcccagt
gggatcccagacttgccccaggacacctttatccagtttcctggatggaccaagggccag
gtctggattaatggctttaaccttggccgctattggccagcccggggccctcagttgacc
ttgtttgtgccccagcacatcctgatgacctcggccccaaacaccatcaccatgctggaa
ctggagcgggcaccctgcagcaatgatgatccagaactatgtgctgtgacattcgtggac
aggccagttattggctcatctgtgacctacgatcatccctccaaacctgttgaaaaaaga
ctcatgccctcacccccccaaaaaaacaaagattcatggctggaccatgtatga

  All links  
No link information was found.   
DBGET integrated database retrieval system